Myotis brandtii (Brandt's bat): 102256872 Help Entry 102256872         CDS       T02920                                  Symbol GNAI1 Name (RefSeq) G protein subunit alpha i1   KO K04630   guanine nucleotide-binding protein G(i) subunit alpha Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04015   Rap1 signaling pathway myb04022   cGMP-PKG signaling pathway myb04024   cAMP signaling pathway myb04062   Chemokine signaling pathway myb04071   Sphingolipid signaling pathway myb04081   Hormone signaling myb04082   Neuroactive ligand signaling myb04261   Adrenergic signaling in cardiomyocytes myb04360   Axon guidance myb04371   Apelin signaling pathway myb04540   Gap junction myb04611   Platelet activation myb04670   Leukocyte transendothelial migration myb04713   Circadian entrainment myb04723   Retrograde endocannabinoid signaling myb04724   Glutamatergic synapse myb04725   Cholinergic synapse myb04726   Serotonergic synapse myb04727   GABAergic synapse myb04728   Dopaminergic synapse myb04730   Long-term depression myb04914   Progesterone-mediated oocyte maturation myb04915   Estrogen signaling pathway myb04916   Melanogenesis myb04921   Oxytocin signaling pathway myb04923   Regulation of lipolysis in adipocytes myb04924   Renin secretion myb04926   Relaxin signaling pathway myb04928   Parathyroid hormone synthesis, secretion and action myb04934   Cushing syndrome myb04935   Growth hormone synthesis, secretion and action myb04971   Gastric acid secretion myb05012   Parkinson disease myb05030   Cocaine addiction myb05032   Morphine addiction myb05034   Alcoholism myb05133   Pertussis myb05142   Chagas disease myb05145   Toxoplasmosis myb05163   Human cytomegalovirus infection myb05170   Human immunodeficiency virus 1 infection myb05200   Pathways in cancer myb05207   Chemical carcinogenesis - receptor activation Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102256872 (GNAI1)    04371 Apelin signaling pathway     102256872 (GNAI1)    04071 Sphingolipid signaling pathway     102256872 (GNAI1)    04024 cAMP signaling pathway     102256872 (GNAI1)    04022 cGMP-PKG signaling pathway     102256872 (GNAI1)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102256872 (GNAI1)    04081 Hormone signaling     102256872 (GNAI1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04540 Gap junction     102256872 (GNAI1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102256872 (GNAI1)    04670 Leukocyte transendothelial migration     102256872 (GNAI1)    04062 Chemokine signaling pathway     102256872 (GNAI1)   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102256872 (GNAI1)    04915 Estrogen signaling pathway     102256872 (GNAI1)    04914 Progesterone-mediated oocyte maturation     102256872 (GNAI1)    04921 Oxytocin signaling pathway     102256872 (GNAI1)    04926 Relaxin signaling pathway     102256872 (GNAI1)    04935 Growth hormone synthesis, secretion and action     102256872 (GNAI1)    04928 Parathyroid hormone synthesis, secretion and action     102256872 (GNAI1)    04916 Melanogenesis     102256872 (GNAI1)    04924 Renin secretion     102256872 (GNAI1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102256872 (GNAI1)   09154 Digestive system    04971 Gastric acid secretion     102256872 (GNAI1)   09156 Nervous system    04724 Glutamatergic synapse     102256872 (GNAI1)    04727 GABAergic synapse     102256872 (GNAI1)    04725 Cholinergic synapse     102256872 (GNAI1)    04728 Dopaminergic synapse     102256872 (GNAI1)    04726 Serotonergic synapse     102256872 (GNAI1)    04730 Long-term depression     102256872 (GNAI1)    04723 Retrograde endocannabinoid signaling     102256872 (GNAI1)   09158 Development and regeneration    04360 Axon guidance     102256872 (GNAI1)   09159 Environmental adaptation    04713 Circadian entrainment     102256872 (GNAI1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102256872 (GNAI1)    05207 Chemical carcinogenesis - receptor activation     102256872 (GNAI1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102256872 (GNAI1)    05163 Human cytomegalovirus infection     102256872 (GNAI1)   09171 Infectious disease: bacterial    05133 Pertussis     102256872 (GNAI1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102256872 (GNAI1)    05142 Chagas disease     102256872 (GNAI1)   09164 Neurodegenerative disease    05012 Parkinson disease     102256872 (GNAI1)   09165 Substance dependence    05030 Cocaine addiction     102256872 (GNAI1)    05032 Morphine addiction     102256872 (GNAI1)    05034 Alcoholism     102256872 (GNAI1)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102256872 (GNAI1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102256872 (GNAI1)    04031 GTP-binding proteins [BR:myb04031]     102256872 (GNAI1) Exosome [BR:myb04147]  Exosomal proteins   Proteins found in most exosomes    102256872 (GNAI1) GTP-binding proteins [BR:myb04031]  Heterotrimeric G-proteins   Alpha Subunits    Alpha type 1 (Gi/o) [OT]     102256872 (GNAI1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-alpha Arf Motif Other DBs NCBI-GeneID:  102256872 NCBI-ProteinID:  XP_014392468 LinkDB All DBs Position Un AA seq 302 aa AA seqDB search MKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAG AAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQSNYIPTQQ DVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDL VLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICYPEYAG SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCG LF NT seq 909 nt NT seq  +upstreamnt  +downstreamnt atgaaaattatccatgaggctggctattcggaagaagaatgtaaacagtacaaagcagtg gtctacagtaacaccattcagtcaattattgctatcattagagccatggggaggttgaag atagacttcggtgactcagctcgggcggatgatgcacgccaactctttgtgcttgctgga gccgctgaagaaggtttcatgactgcagaacttgccggagttataaagagattgtggaaa gatagtggtgtgcaagcctgtttcaacagatcccgagagtaccagcttaatgactctgca gcatactacttgaatgacttggacagaatagcacagtcaaattacattccaactcaacaa gatgtcctcagaactcgagtgaaaactacaggaattgttgaaacccattttactttcaaa gatcttcactttaaaatgtttgatgtgggaggacagaggtctgagcggaagaaatggatt cactgctttgagggagtgaccgccatcattttctgtgtggcgctgagtgactacgacctg gttctagctgaagacgaagaaatgaatcgaatgcatgaaagcatgaagttgttcgattcc atatgtaacaacaaatggtttacagaaacatccatcatactttttctaaacaagaaggat ctctttgaagaaaaaatcaaaaagagccctctcaccatatgctacccagaatatgcaggc tcgaacacatatgaagaggcagctgcatacattcaatgtcagtttgaagacctcaataag agaaaggacacaaaggaaatatacacccacttcacatgtgccacagatactaagaatgtg cagtttgtttttgatgccgtaacagatgtcatcataaaaaataatttaaaagattgtggt ctcttctaa

DBGET integrated database retrieval system