Myotis brandtii (Brandt's bat): 102257160 Help Entry 102257160         CDS       T02920                                  Symbol RHEB Name (RefSeq) Ras homolog enriched in brain   KO K07208   Ras homolog enriched in brain Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04072   Phospholipase D signaling pathway myb04140   Autophagy - animal myb04150   mTOR signaling pathway myb04151   PI3K-Akt signaling pathway myb04152   AMPK signaling pathway myb04211   Longevity regulating pathway myb04218   Cellular senescence myb04714   Thermogenesis myb04910   Insulin signaling pathway myb04919   Thyroid hormone signaling pathway myb05163   Human cytomegalovirus infection myb05165   Human papillomavirus infection myb05168   Herpes simplex virus 1 infection myb05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102257160 (RHEB)    04151 PI3K-Akt signaling pathway     102257160 (RHEB)    04152 AMPK signaling pathway     102257160 (RHEB)    04150 mTOR signaling pathway     102257160 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102257160 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     102257160 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102257160 (RHEB)    04919 Thyroid hormone signaling pathway     102257160 (RHEB)   09149 Aging    04211 Longevity regulating pathway     102257160 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     102257160 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102257160 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102257160 (RHEB)    05163 Human cytomegalovirus infection     102257160 (RHEB)    05165 Human papillomavirus infection     102257160 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:myb04031]     102257160 (RHEB) GTP-binding proteins [BR:myb04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102257160 (RHEB) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RhoGAP_pG2 RsgA_GTPase Motif Other DBs NCBI-GeneID:  102257160 NCBI-ProteinID:  XP_005880164 LinkDB All DBs Position Un AA seq 204 aa AA seqDB search MGSSRLLTLLSSLPRCWARGQEAPRVIRHLSGGAASRRKSSLTIQFVEGQFVDSYDPTIE NTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH GKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVF RRIILEAEKIDGAASQGKSSCWVM NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgggctccagccgcttgctcacccttttgtcgtcgcttcctcggtgctgggcgaggggt caggaggctccgagagtcatccggcacctctcgggcggcgcggcatcacgtcggaaatcc tcgttgacgattcagtttgttgaaggccaatttgttgactcctatgacccaaccatagag aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagac actgctgggcaagatgaatattccatctttccccagacgtactccatagatattaatggt tatattctcgtgtattctgtgacatcgatcaaaagttttgaggtgattaaagttatccat ggcaagttgttggacatggtggggaaagtgcaaatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaggcgttagcagaatct tggaatgcagcttttttggaatcttctgctaaagagaatcaaactgctgttgatgtgttc agaaggataattttggaggcagaaaaaattgatggggctgcttcacaaggaaagtcttcc tgctgggtgatgtaa

DBGET integrated database retrieval system