Myotis brandtii (Brandt's bat): 102257260 Help Entry 102257260         CDS       T02920                                  Symbol CDC42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04010   MAPK signaling pathway myb04014   Ras signaling pathway myb04015   Rap1 signaling pathway myb04062   Chemokine signaling pathway myb04144   Endocytosis myb04360   Axon guidance myb04370   VEGF signaling pathway myb04510   Focal adhesion myb04520   Adherens junction myb04530   Tight junction myb04660   T cell receptor signaling pathway myb04666   Fc gamma R-mediated phagocytosis myb04670   Leukocyte transendothelial migration myb04722   Neurotrophin signaling pathway myb04810   Regulation of actin cytoskeleton myb04912   GnRH signaling pathway myb04932   Non-alcoholic fatty liver disease myb04933   AGE-RAGE signaling pathway in diabetic complications myb05100   Bacterial invasion of epithelial cells myb05132   Salmonella infection myb05135   Yersinia infection myb05165   Human papillomavirus infection myb05200   Pathways in cancer myb05203   Viral carcinogenesis myb05205   Proteoglycans in cancer myb05211   Renal cell carcinoma myb05212   Pancreatic cancer myb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102257260 (CDC42)    04014 Ras signaling pathway     102257260 (CDC42)    04015 Rap1 signaling pathway     102257260 (CDC42)    04370 VEGF signaling pathway     102257260 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102257260 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102257260 (CDC42)    04520 Adherens junction     102257260 (CDC42)    04530 Tight junction     102257260 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102257260 (CDC42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102257260 (CDC42)    04666 Fc gamma R-mediated phagocytosis     102257260 (CDC42)    04670 Leukocyte transendothelial migration     102257260 (CDC42)    04062 Chemokine signaling pathway     102257260 (CDC42)   09152 Endocrine system    04912 GnRH signaling pathway     102257260 (CDC42)   09156 Nervous system    04722 Neurotrophin signaling pathway     102257260 (CDC42)   09158 Development and regeneration    04360 Axon guidance     102257260 (CDC42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102257260 (CDC42)    05205 Proteoglycans in cancer     102257260 (CDC42)    05203 Viral carcinogenesis     102257260 (CDC42)   09162 Cancer: specific types    05212 Pancreatic cancer     102257260 (CDC42)    05211 Renal cell carcinoma     102257260 (CDC42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     102257260 (CDC42)   09171 Infectious disease: bacterial    05132 Salmonella infection     102257260 (CDC42)    05135 Yersinia infection     102257260 (CDC42)    05100 Bacterial invasion of epithelial cells     102257260 (CDC42)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102257260 (CDC42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102257260 (CDC42)    04933 AGE-RAGE signaling pathway in diabetic complications     102257260 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myb04131]     102257260 (CDC42)    03036 Chromosome and associated proteins [BR:myb03036]     102257260 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102257260 (CDC42)    04031 GTP-binding proteins [BR:myb04031]     102257260 (CDC42) Membrane trafficking [BR:myb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     102257260 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     102257260 (CDC42)   Macropinocytosis    Ras GTPases     102257260 (CDC42) Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102257260 (CDC42) Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of microglial cells    102257260 (CDC42)   Exosomal proteins of breast milk    102257260 (CDC42) GTP-binding proteins [BR:myb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102257260 (CDC42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  102257260 NCBI-ProteinID:  XP_005859731 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIXGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAISAALEPP EPKKSRRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaagtgcgttgttgtgggcgatggtgctgttggtaaaacatgtcttctg atatcctacacaacaaacaaatttccatctgagtatgtaccgactgtttttgacaactat gcagtcacagttatgattnngggagagccatatactcttggactttttgatactgcaggg caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga gatgatccctctacgattgagaaacttgccaagaacaaacagaaacctatcactccagag actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc acacagaaaggcctaaagaatgtatttgacgaagcaatatcggctgccctggagcctcca gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system