Myotis brandtii (Brandt's bat): 102257528 Help Entry 102257528         CDS       T02920                                  Name (RefSeq) autophagy-related protein 101   KO K19730   autophagy-related protein 101 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04136   Autophagy - other myb04140   Autophagy - animal myb04211   Longevity regulating pathway myb05010   Alzheimer disease myb05014   Amyotrophic lateral sclerosis myb05016   Huntington disease myb05017   Spinocerebellar ataxia myb05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:myb00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102257528    04136 Autophagy - other     102257528  09150 Organismal Systems   09149 Aging    04211 Longevity regulating pathway     102257528  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     102257528    05014 Amyotrophic lateral sclerosis     102257528    05016 Huntington disease     102257528    05017 Spinocerebellar ataxia     102257528    05022 Pathways of neurodegeneration - multiple diseases     102257528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myb04131]     102257528 Membrane trafficking [BR:myb04131]  Autophagy   Autophagosome formation proteins    ULK complex     102257528 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG101 Motif Other DBs NCBI-GeneID:  102257528 NCBI-ProteinID:  XP_005852860 UniProt:  S7NS48 LinkDB All DBs Position Un AA seq 150 aa AA seqDB search MRTPVLACYLLPFLPQDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHV VALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPY LYKISFQITDALGTSVTTTMRRLIKDTLAL NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgagaactcctgtcctagcctgttatctgctaccctttcttccccaggatgcactgcgc aactcaggtggcgatgggctagggcagatgtccttggagttctaccagaagaagaagtct cgctggcctttctcagacgagtgcatcccctgggaagtgtggacagtcaaggtgcatgtg gtggccctggccacggagcaggagcggcagatctgccgggagaaggtgggtgagaagctc tgtgagaagatcatcaacatcgtggaggtgatgaaccggcatgagtacctgcccaagatg cccacgcagtcggaggtggacaacgtgtttgacacaggcttgcgggacgtgcagccctac ctctacaaaatctccttccaaatcaccgatgccctgggcacctcagtcaccaccaccatg cgcaggctcatcaaagacacccttgctctctag

DBGET integrated database retrieval system