Myotis brandtii (Brandt's bat): 102258260 Help Entry 102258260         CDS       T02920                                  Symbol MYL2 Name (RefSeq) myosin light chain 2   KO K10351   myosin regulatory light chain 2 Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04260   Cardiac muscle contraction myb04261   Adrenergic signaling in cardiomyocytes myb04371   Apelin signaling pathway myb04510   Focal adhesion myb04520   Adherens junction myb04530   Tight junction myb04670   Leukocyte transendothelial migration myb04810   Regulation of actin cytoskeleton myb04814   Motor proteins myb04820   Cytoskeleton in muscle cells myb05132   Salmonella infection myb05410   Hypertrophic cardiomyopathy myb05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:myb00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102258260 (MYL2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102258260 (MYL2)    04520 Adherens junction     102258260 (MYL2)    04530 Tight junction     102258260 (MYL2)   09142 Cell motility    04814 Motor proteins     102258260 (MYL2)    04820 Cytoskeleton in muscle cells     102258260 (MYL2)    04810 Regulation of actin cytoskeleton     102258260 (MYL2)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102258260 (MYL2)   09153 Circulatory system    04260 Cardiac muscle contraction     102258260 (MYL2)    04261 Adrenergic signaling in cardiomyocytes     102258260 (MYL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102258260 (MYL2)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     102258260 (MYL2)    05414 Dilated cardiomyopathy     102258260 (MYL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myb04812]     102258260 (MYL2) Cytoskeleton proteins [BR:myb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102258260 (MYL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SAPC2_N EF-hand_FSTL1 AIF-1 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  102258260 NCBI-ProteinID:  XP_005876299 LinkDB All DBs Position Un AA seq 166 aa AA seqDB search MAPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VQNEEIDDMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIK EMLTTQAERFSNEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaagccaagaagagagccgagggcgccaattccaacgtgttctccatg tttgaacagacccagatccaggaatttaaggaggccttcaccatcatggaccagaacagg gatggcttcatcgacaagaatgatctgagggacacctttgctgctcttgggcgtgtgaac gtgcaaaatgaggaaatcgatgacatgataaaggaagccccaggtcccattaactttacc gtgttcctaacgatgtttggggagaaacttaagggggcagaccctgaagagaccattctc aacgcgttcaaagtgtttgaccccgaaggcaaaggggtgctgaaggctgattacattaag gagatgctgaccacacaggcggagagattttccaacgaggagattgaccagatgtttgcc gccttcccccctgatgtgactggcaacttggactataagaacctggtgcacatcatcacc catggagaagaaaaggactga

DBGET integrated database retrieval system