Myotis brandtii (Brandt's bat): 102258300 Help Entry 102258300         CDS       T02920                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism myb  Myotis brandtii (Brandt's bat) Pathway myb04613   Neutrophil extracellular trap formation myb05034   Alcoholism myb05203   Viral carcinogenesis myb05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:myb00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102258300  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102258300   09163 Immune disease    05322 Systemic lupus erythematosus     102258300   09165 Substance dependence    05034 Alcoholism     102258300  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myb03036]     102258300   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myb04147]     102258300 Chromosome and associated proteins [BR:myb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102258300 Exosome [BR:myb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102258300 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 CENP-T_C DUF1931 Motif Other DBs NCBI-GeneID:  102258300 NCBI-ProteinID:  XP_005863213 UniProt:  S7MQZ0 LinkDB All DBs Position Un AA seq 127 aa AA seqDB search MPELASKGATISKKGFKKAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVNDIFERLSAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggagctggcttcgaagggcgccactatttccaagaagggctttaagaaggccgtg accaagacccagaagaaagagggcaagaagcgcaagaggtgccgcaaggagagctactcg atttacatctacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggcc atgagcatcatgaactcgtttgtcaatgacatttttgagcgcctctctgctgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacctctcgcgagatccagacggccgtg cgcctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaaataa

DBGET integrated database retrieval system