Myotis brandtii (Brandt's bat): 20964700 Help Entry 20964700          CDS       T02920                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism myb  Myotis brandtii (Brandt's bat) Pathway myb00190   Oxidative phosphorylation myb01100   Metabolic pathways myb04714   Thermogenesis myb04723   Retrograde endocannabinoid signaling myb05010   Alzheimer disease myb05012   Parkinson disease myb05014   Amyotrophic lateral sclerosis myb05016   Huntington disease myb05020   Prion disease myb05022   Pathways of neurodegeneration - multiple diseases myb05208   Chemical carcinogenesis - reactive oxygen species myb05415   Diabetic cardiomyopathy Module myb_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:myb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     20964700 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     20964700 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     20964700 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     20964700 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     20964700 (ND4L)    05012 Parkinson disease     20964700 (ND4L)    05014 Amyotrophic lateral sclerosis     20964700 (ND4L)    05016 Huntington disease     20964700 (ND4L)    05020 Prion disease     20964700 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     20964700 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     20964700 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:myb03029]     20964700 (ND4L) Enzymes [BR:myb01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      20964700 (ND4L) Mitochondrial biogenesis [BR:myb03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     20964700 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 NAD4L Motif Other DBs NCBI-GeneID:  20964700 NCBI-ProteinID:  YP_009092851 UniProt:  A0A0M4FNW2 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MSLTHMNILLAFITSLLGLLMYRSHLMSSLLCLEGMMLSLFVLITMTILIAHTTLASMIP IILLVFAACEAALGLSLLVVVSNTYGIDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctttaacccacataaacattttactagcattcattacatcccttctaggactactt atatatcgatcccacctaatgtcctcgctcctatgcctggagggaataatgctatcttta ttcgtccttatcactataactattcttattgcccacacaactctggccagtataattcct attatcctgttagtatttgcagcttgtgaagcagcactcgggctgtccttactagtagtt gtatctaatacatacggaattgactatgtacaaaaccttaatcttcttcaatgctaa

DBGET integrated database retrieval system