Myotis davidii (David's myotis): 102752144 Help Entry 102752144         CDS       T02992                                  Symbol DYNLL2 Name (RefSeq) dynein light chain LC8-type 2   KO K10418   dynein light chain LC8-type Organism myd  Myotis davidii (David's myotis) Pathway myd04145   Phagocytosis myd04517   IgSF CAM signaling myd04814   Motor proteins myd04962   Vasopressin-regulated water reabsorption myd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102752144 (DYNLL2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     102752144 (DYNLL2)   09142 Cell motility    04814 Motor proteins     102752144 (DYNLL2)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102752144 (DYNLL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102752144 (DYNLL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myd03037]     102752144 (DYNLL2)    04812 Cytoskeleton proteins [BR:myd04812]     102752144 (DYNLL2) Cilium and associated proteins [BR:myd03037]  Motile cilia and associated proteins   Dynein arm    102752144 (DYNLL2) Cytoskeleton proteins [BR:myd04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102752144 (DYNLL2) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  102752144 NCBI-ProteinID:  XP_006756274 UniProt:  L5MCD1 LinkDB All DBs Position Un AA seq 89 aa AA seqDB search MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccggaaggccgtgatcaagaatgcagacatgtctgaggacatgcaacaggat gccgttgactgcgccacgcaggctatggagaagtacaacatagagaaggacattgctgcc tatatcaagaaggaatttgacaagaaatacaaccctacctggcattgtattgtgggccga aattttggcagctacgttacacacgagacaaagcacttcatctatttttacttgggtcaa gttgcaatcctcctcttcaagtcaggctag

DBGET integrated database retrieval system