Myotis davidii (David's myotis): 102753168 Help Entry 102753168         CDS       T02992                                  Symbol POLR2G Name (RefSeq) RNA polymerase II subunit G   KO K03015   DNA-directed RNA polymerase II subunit RPB7 Organism myd  Myotis davidii (David's myotis) Pathway myd03020   RNA polymerase myd03420   Nucleotide excision repair myd05016   Huntington disease Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     102753168 (POLR2G)   09124 Replication and repair    03420 Nucleotide excision repair     102753168 (POLR2G)  09160 Human Diseases   09164 Neurodegenerative disease    05016 Huntington disease     102753168 (POLR2G)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:myd03021]     102753168 (POLR2G)    03019 Messenger RNA biogenesis [BR:myd03019]     102753168 (POLR2G)    03400 DNA repair and recombination proteins [BR:myd03400]     102753168 (POLR2G) Transcription machinery [BR:myd03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      102753168 (POLR2G) Messenger RNA biogenesis [BR:myd03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      102753168 (POLR2G) DNA repair and recombination proteins [BR:myd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       102753168 (POLR2G) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S1 SHS2_Rpb7-N RNA_pol_Rbc25 Motif Other DBs NCBI-GeneID:  102753168 NCBI-ProteinID:  XP_006772858 LinkDB All DBs Position Un AA seq 174 aa AA seqDB search MLTGLSILGDTTGFKFTNSNSNTQDSTRLFPTQGLSLCRPPRRYGFVIAVTTIDNIGAGV IQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEME FDPNSNPPCYKTMDEDIVIQQGDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgctcacgggtctgtccattcttggagatactactggcttcaaattcaccaacagcaac agcaacactcaggacagcacaaggctcttccccacacagggcctttctctttgtcgtcct cctcgcaggtatggcttcgtcattgctgtcaccaccatcgacaatattggggctggtgtg atccagccaggcaggggctttgtcctttacccagttaagtacaaggccattgttttccgg ccctttaaaggggaagtcgtggatgctgtcgtcactcaggtcaacaaggttggactcttc acagaaatcggacccatgtcctgcttcatctcccgacattccatcccgtccgagatggag ttcgatcctaactccaacccaccgtgttacaagacaatggatgaggacattgtgattcag cagggcgatgagatccgcctgaagattgtggggacccgtgtggacaagaacgacattttt gccatcggctctttgatggatgattacttggggcttgtgagctga

DBGET integrated database retrieval system