Myotis davidii (David's myotis): 102753598 Help Entry 102753598         CDS       T02992                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism myd  Myotis davidii (David's myotis) Pathway myd04010   MAPK signaling pathway myd04014   Ras signaling pathway myd04015   Rap1 signaling pathway myd04022   cGMP-PKG signaling pathway myd04066   HIF-1 signaling pathway myd04068   FoxO signaling pathway myd04072   Phospholipase D signaling pathway myd04081   Hormone signaling myd04114   Oocyte meiosis myd04140   Autophagy - animal myd04150   mTOR signaling pathway myd04151   PI3K-Akt signaling pathway myd04152   AMPK signaling pathway myd04211   Longevity regulating pathway myd04213   Longevity regulating pathway - multiple species myd04810   Regulation of actin cytoskeleton myd04910   Insulin signaling pathway myd04911   Insulin secretion myd04913   Ovarian steroidogenesis myd04914   Progesterone-mediated oocyte maturation myd04917   Prolactin signaling pathway myd04923   Regulation of lipolysis in adipocytes myd04930   Type II diabetes mellitus myd04931   Insulin resistance myd04932   Non-alcoholic fatty liver disease myd04940   Type I diabetes mellitus myd04950   Maturity onset diabetes of the young myd04960   Aldosterone-regulated sodium reabsorption myd05010   Alzheimer disease myd05215   Prostate cancer myd05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102753598 (INS)    04014 Ras signaling pathway     102753598 (INS)    04015 Rap1 signaling pathway     102753598 (INS)    04066 HIF-1 signaling pathway     102753598 (INS)    04068 FoxO signaling pathway     102753598 (INS)    04072 Phospholipase D signaling pathway     102753598 (INS)    04022 cGMP-PKG signaling pathway     102753598 (INS)    04151 PI3K-Akt signaling pathway     102753598 (INS)    04152 AMPK signaling pathway     102753598 (INS)    04150 mTOR signaling pathway     102753598 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     102753598 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102753598 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     102753598 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102753598 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102753598 (INS)    04910 Insulin signaling pathway     102753598 (INS)    04923 Regulation of lipolysis in adipocytes     102753598 (INS)    04913 Ovarian steroidogenesis     102753598 (INS)    04914 Progesterone-mediated oocyte maturation     102753598 (INS)    04917 Prolactin signaling pathway     102753598 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102753598 (INS)   09149 Aging    04211 Longevity regulating pathway     102753598 (INS)    04213 Longevity regulating pathway - multiple species     102753598 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     102753598 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102753598 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102753598 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102753598 (INS)    04940 Type I diabetes mellitus     102753598 (INS)    04950 Maturity onset diabetes of the young     102753598 (INS)    04932 Non-alcoholic fatty liver disease     102753598 (INS)    04931 Insulin resistance     102753598 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102753598 (INS) Cytokines and neuropeptides [BR:myd04052]  Neuropeptides   Unclassified    102753598 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  102753598 NCBI-ProteinID:  XP_015420950 LinkDB All DBs Position Un AA seq 106 aa AA seqDB search MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKDRRELPD PQEEEVEMDEGGLQALTLEGLLQKRGIVEECCTNVCSLYQLERYCN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctcgccctgctggccctctgggcgcccgcc cccgcccaggccttcgtgaaccagcacctgtgcggctcacacctggtggaggctctgtac ctggtgtgcggggagcggggcttcttctacacgcccaaggaccgccgggagctgcccgac ccgcaggaggaggaggtggagatggacgaaggtggcctgcaggccctgaccctggagggg ctcctgcagaagcgcggcatcgtggaggagtgctgcaccaatgtctgctcgctctaccag ctggagagatactgcaactag

DBGET integrated database retrieval system