Myotis davidii (David's myotis): 102755072 Help Entry 102755072         CDS       T02992                                  Symbol RPA3 Name (RefSeq) replication protein A3   KO K10740   replication factor A3 Organism myd  Myotis davidii (David's myotis) Pathway myd03030   DNA replication myd03420   Nucleotide excision repair myd03430   Mismatch repair myd03440   Homologous recombination myd03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     102755072 (RPA3)    03420 Nucleotide excision repair     102755072 (RPA3)    03430 Mismatch repair     102755072 (RPA3)    03440 Homologous recombination     102755072 (RPA3)    03460 Fanconi anemia pathway     102755072 (RPA3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:myd03032]     102755072 (RPA3)    03400 DNA repair and recombination proteins [BR:myd03400]     102755072 (RPA3) DNA replication proteins [BR:myd03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     102755072 (RPA3) DNA repair and recombination proteins [BR:myd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      102755072 (RPA3)    MMR (mismatch excision repair)      102755072 (RPA3)   DSBR (double strand breaks repair)    HR (homologous recombination)      102755072 (RPA3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 DUF356 Motif Other DBs NCBI-GeneID:  102755072 NCBI-ProteinID:  XP_006779314 LinkDB All DBs Position Un AA seq 122 aa AA seqDB search MMVEVMELPKSRINASMLAQSIDRPVCFVGRLEKIHPTGKMFILSDGEGKSATIELMEPL DEEISGIVEVVGRVTAKATIMCSSYVQFKEDNHPFDLGLYNEAVKIIHEFPQFFPLGVMQ YD NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgatggtggaggtgatggagttgcccaagtcgcgtatcaacgccagcatgctagcccag tccatcgaccggcccgtctgcttcgtagggaggctggaaaagattcatcccactggaaaa atgtttattctttcagatggagaagggaaaagtgcaaccattgaattgatggagcctctt gatgaagaaatctctggaatcgtggaagtagttggaagagtaacagccaaggcaaccatt atgtgctcatcttatgtccagtttaaagaagataaccatccttttgatcttggactttac aatgaagctgtgaaaattatccatgagttccctcagttttttcctttgggggttatgcag tatgattga

DBGET integrated database retrieval system