Myotis davidii (David's myotis): 102755287 Help Entry 102755287         CDS       T02992                                  Symbol CLDN5, Claudin-5 Name (RefSeq) claudin 5   KO K06087   claudin Organism myd  Myotis davidii (David's myotis) Pathway myd03272   Virion - Hepatitis viruses myd04382   Cornified envelope formation myd04514   Cell adhesion molecule (CAM) interaction myd04530   Tight junction myd04670   Leukocyte transendothelial migration myd05160   Hepatitis C Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102755287 (CLDN5)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102755287 (CLDN5)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102755287 (CLDN5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102755287 (CLDN5)   09158 Development and regeneration    04382 Cornified envelope formation     102755287 (CLDN5)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102755287 (CLDN5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myd03037]     102755287 (CLDN5)    04147 Exosome [BR:myd04147]     102755287 (CLDN5) Cilium and associated proteins [BR:myd03037]  Other cilia and associated proteins   Stereociliary proteins    102755287 (CLDN5) Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102755287 (CLDN5)   Exosomal proteins of colorectal cancer cells    102755287 (CLDN5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like Motif Other DBs NCBI-GeneID:  102755287 NCBI-ProteinID:  XP_006779376 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MGSAALEILGLVLCLMGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG HMQCKMYDSVLALSAEVQAARALTVGAALLALLALCLPLXXXXXXXXXXXXXXXARVALA GGALYAFCGLLALVPLCWFANIVVREFYDPNVSVSNKYELGAAFRDLSFPVKYSAPRRPA ASGDYDKKNYV NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atggggtcggcggcgctggagatcctcggcctggtgctgtgcctgatgggctgggtgggc ctgatcctggcgtgcgggctgcccatgtggcaggtgaccgctttcctggaccacaacatc gtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtggtgcagagcacgggg cacatgcagtgcaagatgtatgactcggtgctggcgctgagcgccgaggtgcaggcggcg cgggcgctcaccgtgggcgccgcactgctggcgctcctcgcgctctgcctgcccctnnnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngcgcgcgtggctctcgcg ggcggcgcgctctacgcattctgcgggctgctggcgctcgtgccgctctgctggttcgcc aacatcgtggtccgcgaattctacgacccgaatgtatccgtgtcaaacaagtacgaactg ggggcagcgttccgggacctcagcttccccgtcaagtattcggcgccgcgacggcccgcg gccagcggcgactacgacaagaaaaactacgtctga

DBGET integrated database retrieval system