Myotis davidii (David's myotis): 102755850 Help Entry 102755850         CDS       T02992                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism myd  Myotis davidii (David's myotis) Pathway myd04024   cAMP signaling pathway myd04080   Neuroactive ligand-receptor interaction myd04081   Hormone signaling myd04935   Growth hormone synthesis, secretion and action myd04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102755850 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102755850 (SST)    04081 Hormone signaling     102755850 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102755850 (SST)   09154 Digestive system    04971 Gastric acid secretion     102755850 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102755850 (SST) Cytokines and neuropeptides [BR:myd04052]  Neuropeptides   GPCR binding    102755850 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  102755850 NCBI-ProteinID:  XP_006765918 UniProt:  L5LQE4 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MMSCRLQCALAALSIVLALSSVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAADQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgatgtcctgccgcctccagtgcgcgctggccgcgctctccatcgtcctggctttgagc agtgtcactggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgccgcagggaagcaggaactagccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggaacctgaagatttgtcccaggctgctgaccaggat gaaatgaggctggagctgcagagatccactaactcgaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system