Myotis davidii (David's myotis): 102756255 Help Entry 102756255         CDS       T02992                                  Symbol PRCD Name (RefSeq) photoreceptor disc component   KO K19637   progressive rod-cone degeneration protein Organism myd  Myotis davidii (David's myotis) Brite KEGG Orthology (KO) [BR:myd00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myd03037]     102756255 (PRCD) Cilium and associated proteins [BR:myd03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    102756255 (PRCD) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rod_cone_degen Motif Other DBs NCBI-GeneID:  102756255 NCBI-ProteinID:  XP_006756443 LinkDB All DBs Position Un AA seq 53 aa AA seqDB search MCTTLLLLSTLALLWRRRFANRVQPEPSEADGAVLGGSLQTDTQSPGREKPVE NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgtgcaccaccctcctcctgctcagcaccttggctctgctctggcgccgccgatttgcc aaccgggtccaaccagagcccagcgaagcagacggggcggtcctgggcggcagcctgcag acagacacccagtcccctggcagggagaagcctgtggagtaa

DBGET integrated database retrieval system