Myotis davidii (David's myotis): 102758002 Help Entry 102758002         CDS       T02992                                  Name (RefSeq) protein Wnt-7a   KO K00572   wingless-type MMTV integration site family, member 7 Organism myd  Myotis davidii (David's myotis) Pathway myd04150   mTOR signaling pathway myd04310   Wnt signaling pathway myd04390   Hippo signaling pathway myd04550   Signaling pathways regulating pluripotency of stem cells myd04916   Melanogenesis myd04934   Cushing syndrome myd05010   Alzheimer disease myd05022   Pathways of neurodegeneration - multiple diseases myd05165   Human papillomavirus infection myd05200   Pathways in cancer myd05205   Proteoglycans in cancer myd05217   Basal cell carcinoma myd05224   Breast cancer myd05225   Hepatocellular carcinoma myd05226   Gastric cancer Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102758002    04390 Hippo signaling pathway     102758002    04150 mTOR signaling pathway     102758002  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102758002  09150 Organismal Systems   09152 Endocrine system    04916 Melanogenesis     102758002  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102758002    05205 Proteoglycans in cancer     102758002   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102758002    05226 Gastric cancer     102758002    05217 Basal cell carcinoma     102758002    05224 Breast cancer     102758002   09172 Infectious disease: viral    05165 Human papillomavirus infection     102758002   09164 Neurodegenerative disease    05010 Alzheimer disease     102758002    05022 Pathways of neurodegeneration - multiple diseases     102758002   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102758002  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102758002 Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Morphogens    102758002 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  wnt DUF6973 Motif Other DBs NCBI-GeneID:  102758002 NCBI-ProteinID:  XP_006767202 UniProt:  L5LNP1 LinkDB All DBs Position Un AA seq 195 aa AA seqDB search MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM NLHNNEAGRKVGRET NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgaatcggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac ctccggatcggtggcttctcctcggtggtagctctgggcgcgagcatcatctgtaacaag atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc cgctggaactgctccgcgctgggggagcgcaccgtcttcgggaaggagctcaaagtgggg agccgggaggctgccttcacctatgccatcatcgctgccggtgtggcccacgccatcaca gctgcctgcacccaaggcaacctaagtgactgtggctgcgacaaggagaagcaaggccag taccaccgggatgagggctggaagtggggtggctgctcggctgacatccgctacggcatc ggctttgccaaggtcttcgtggatgcccgggagatcaagcagaacgccaggacactcatg aacctgcacaacaatgaggcgggccggaaggtagggcgggagacctga

DBGET integrated database retrieval system