Myotis davidii (David's myotis): 102758165 Help Entry 102758165         CDS       T02992                                  Symbol CDC42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism myd  Myotis davidii (David's myotis) Pathway myd04010   MAPK signaling pathway myd04014   Ras signaling pathway myd04015   Rap1 signaling pathway myd04062   Chemokine signaling pathway myd04144   Endocytosis myd04360   Axon guidance myd04370   VEGF signaling pathway myd04510   Focal adhesion myd04517   IgSF CAM signaling myd04518   Integrin signaling myd04520   Adherens junction myd04530   Tight junction myd04660   T cell receptor signaling pathway myd04666   Fc gamma R-mediated phagocytosis myd04670   Leukocyte transendothelial migration myd04722   Neurotrophin signaling pathway myd04810   Regulation of actin cytoskeleton myd04912   GnRH signaling pathway myd04932   Non-alcoholic fatty liver disease myd04933   AGE-RAGE signaling pathway in diabetic complications myd05100   Bacterial invasion of epithelial cells myd05132   Salmonella infection myd05135   Yersinia infection myd05165   Human papillomavirus infection myd05200   Pathways in cancer myd05203   Viral carcinogenesis myd05205   Proteoglycans in cancer myd05211   Renal cell carcinoma myd05212   Pancreatic cancer myd05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102758165 (CDC42)    04014 Ras signaling pathway     102758165 (CDC42)    04015 Rap1 signaling pathway     102758165 (CDC42)    04370 VEGF signaling pathway     102758165 (CDC42)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102758165 (CDC42)    04518 Integrin signaling     102758165 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102758165 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102758165 (CDC42)    04520 Adherens junction     102758165 (CDC42)    04530 Tight junction     102758165 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102758165 (CDC42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102758165 (CDC42)    04666 Fc gamma R-mediated phagocytosis     102758165 (CDC42)    04670 Leukocyte transendothelial migration     102758165 (CDC42)    04062 Chemokine signaling pathway     102758165 (CDC42)   09152 Endocrine system    04912 GnRH signaling pathway     102758165 (CDC42)   09156 Nervous system    04722 Neurotrophin signaling pathway     102758165 (CDC42)   09158 Development and regeneration    04360 Axon guidance     102758165 (CDC42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102758165 (CDC42)    05205 Proteoglycans in cancer     102758165 (CDC42)    05203 Viral carcinogenesis     102758165 (CDC42)   09162 Cancer: specific types    05212 Pancreatic cancer     102758165 (CDC42)    05211 Renal cell carcinoma     102758165 (CDC42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     102758165 (CDC42)   09171 Infectious disease: bacterial    05132 Salmonella infection     102758165 (CDC42)    05135 Yersinia infection     102758165 (CDC42)    05100 Bacterial invasion of epithelial cells     102758165 (CDC42)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102758165 (CDC42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102758165 (CDC42)    04933 AGE-RAGE signaling pathway in diabetic complications     102758165 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myd04131]     102758165 (CDC42)    03036 Chromosome and associated proteins [BR:myd03036]     102758165 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myd04147]     102758165 (CDC42)    04031 GTP-binding proteins [BR:myd04031]     102758165 (CDC42) Membrane trafficking [BR:myd04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     102758165 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     102758165 (CDC42)   Macropinocytosis    Ras GTPases     102758165 (CDC42) Chromosome and associated proteins [BR:myd03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102758165 (CDC42) Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of microglial cells    102758165 (CDC42)   Exosomal proteins of breast milk    102758165 (CDC42) GTP-binding proteins [BR:myd04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102758165 (CDC42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  102758165 NCBI-ProteinID:  XP_006777656 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKSRRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaagtgcgttgttgtgggcgatggtgctgttggtaaaacatgtcttctg atatcctacacaacaaacaaatttccatctgaatatgtaccgactgtttttgacaactat gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc tgtttttcagtggtctctccatcctcatttgaaaatgtgaaggaaaagtgggtgcctgag ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga gatgatccctctacgattgagaaacttgccaagaacaaacagaaacctatcactccagag actgctgaaaagctggcccgtgacttgaaggctgtcaagtatgtggagtgttctgcactc acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system