Myotis davidii (David's myotis): 102758475 Help Entry 102758475         CDS       T02992                                  Symbol RHEB Name (RefSeq) Ras homolog enriched in brain   KO K07208   Ras homolog enriched in brain Organism myd  Myotis davidii (David's myotis) Pathway myd04072   Phospholipase D signaling pathway myd04140   Autophagy - animal myd04150   mTOR signaling pathway myd04151   PI3K-Akt signaling pathway myd04152   AMPK signaling pathway myd04211   Longevity regulating pathway myd04218   Cellular senescence myd04714   Thermogenesis myd04910   Insulin signaling pathway myd04919   Thyroid hormone signaling pathway myd05163   Human cytomegalovirus infection myd05165   Human papillomavirus infection myd05168   Herpes simplex virus 1 infection myd05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102758475 (RHEB)    04151 PI3K-Akt signaling pathway     102758475 (RHEB)    04152 AMPK signaling pathway     102758475 (RHEB)    04150 mTOR signaling pathway     102758475 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102758475 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     102758475 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102758475 (RHEB)    04919 Thyroid hormone signaling pathway     102758475 (RHEB)   09149 Aging    04211 Longevity regulating pathway     102758475 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     102758475 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102758475 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102758475 (RHEB)    05163 Human cytomegalovirus infection     102758475 (RHEB)    05165 Human papillomavirus infection     102758475 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:myd04031]     102758475 (RHEB) GTP-binding proteins [BR:myd04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102758475 (RHEB) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RhoGAP_pG2 RsgA_GTPase MMR_HSR1 Motif Other DBs NCBI-GeneID:  102758475 NCBI-ProteinID:  XP_015421713 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MLIKGTFSDLSTFSFFIGYSGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQ LVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLV GNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQG KSSCSVM NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgctaattaaaggaacattttctgatctcagtaccttcagtttcttcatcggttacagt gggaaatcctcgttgacgattcagtttgttgaaggccaattcgttgactcctatgaccca accatagagaacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaa cttgtagatacagctgggcaagatgaatattccatctttccccagacgtactccatagat attaatggttatattctcgtgtattctgtgacatctatcaaaagttttgaagtgattaaa gttatccatggcaagttgttggacatggtggggaaagtgcaaatacctattatgttggtt gggaataagaaagacctacatatggaaagggtgatcagttatgaagaagggaaggcgtta gcagaatcttggaatgcagcttttttggaatcttctgctaaagagaatcaaactgctgtt gatgttttcagaaggataattttggaggcagaaaaaattgatggggccgcttcacaagga aagtcttcctgctcggtgatgtaa

DBGET integrated database retrieval system