Myotis davidii (David's myotis): 102760528 Help Entry 102760528         CDS       T02992                                  Symbol CDK6 Name (RefSeq) cyclin dependent kinase 6   KO K02091   cyclin-dependent kinase 6 [EC:2.7.11.22] Organism myd  Myotis davidii (David's myotis) Pathway myd04110   Cell cycle myd04115   p53 signaling pathway myd04151   PI3K-Akt signaling pathway myd04218   Cellular senescence myd04934   Cushing syndrome myd05160   Hepatitis C myd05162   Measles myd05163   Human cytomegalovirus infection myd05164   Influenza A myd05165   Human papillomavirus infection myd05167   Kaposi sarcoma-associated herpesvirus infection myd05169   Epstein-Barr virus infection myd05200   Pathways in cancer myd05203   Viral carcinogenesis myd05206   MicroRNAs in cancer myd05212   Pancreatic cancer myd05214   Glioma myd05218   Melanoma myd05220   Chronic myeloid leukemia myd05222   Small cell lung cancer myd05223   Non-small cell lung cancer myd05224   Breast cancer myd05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     102760528 (CDK6)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102760528 (CDK6)    04115 p53 signaling pathway     102760528 (CDK6)    04218 Cellular senescence     102760528 (CDK6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102760528 (CDK6)    05206 MicroRNAs in cancer     102760528 (CDK6)    05203 Viral carcinogenesis     102760528 (CDK6)   09162 Cancer: specific types    05212 Pancreatic cancer     102760528 (CDK6)    05225 Hepatocellular carcinoma     102760528 (CDK6)    05214 Glioma     102760528 (CDK6)    05220 Chronic myeloid leukemia     102760528 (CDK6)    05218 Melanoma     102760528 (CDK6)    05224 Breast cancer     102760528 (CDK6)    05222 Small cell lung cancer     102760528 (CDK6)    05223 Non-small cell lung cancer     102760528 (CDK6)   09172 Infectious disease: viral    05160 Hepatitis C     102760528 (CDK6)    05164 Influenza A     102760528 (CDK6)    05162 Measles     102760528 (CDK6)    05163 Human cytomegalovirus infection     102760528 (CDK6)    05167 Kaposi sarcoma-associated herpesvirus infection     102760528 (CDK6)    05169 Epstein-Barr virus infection     102760528 (CDK6)    05165 Human papillomavirus infection     102760528 (CDK6)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102760528 (CDK6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:myd01001]     102760528 (CDK6) Enzymes [BR:myd01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      102760528 (CDK6) Protein kinases [BR:myd01001]  Serine/threonine kinases: CMGC group   CDK family    102760528 (CDK6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH Haspin_kinase RIO1 Kinase-like FTA2 Uricase Motif Other DBs NCBI-GeneID:  102760528 NCBI-ProteinID:  XP_006779327 LinkDB All DBs Position Un AA seq 273 aa AA seqDB search MPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLNKVP EPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQ MALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILD VIGLPGEEDWPRDVALPRQAFHSKSPQPIENFVSDIDEQGKDLLLKCLTFNPAKRISAYG ALSHPYFHDLERRKESLDSHLPPSQNNSEMNIA NT seq 822 nt NT seq  +upstreamnt  +downstreamnt atgccgctctccaccatccgcgaggtggcggtgctgaggcacctggagaccttcgagcac cccaacgtggtcaggttattcgatgtgtgcacggtgtcacgaacagacagagaaactaaa ctaacattagtgtttgaacatgttgatcaagacttgaccacttatttgaataaagttcca gagcccggagtgcccactgaaaccataaaggatatgatgtttcagcttctccggggtctg gactttcttcattctcaccgcgtagtgcaccgtgatctaaaaccacagaacattctggtg accagcagcggacaaataaaactggctgactttggccttgcccgcatctacagttttcag atggctctgacctcagtggtcgtcacgctgtggtaccgggcccccgaagtcctgctgcag tccagctacgccacccccgtggacctctggagtgtcggctgcatattcgcagaaatgttt cgtagaaagcctctttttcgtggaagttcagatgtggatcaactaggaaaaatcttggac gtaattggactcccaggagaagaggactggcctagagatgtggcccttcccaggcaggct tttcactcaaaatctcctcaacctattgagaattttgtaagcgacattgatgaacaaggc aaagacctacttctgaagtgcttgacatttaatccagccaaaagaatatctgcctacggt gccctgtctcacccatacttccacgacctggagaggcgcaaggagagcctggattcccac ctgccacccagccagaacaactcggagatgaatatagcctga

DBGET integrated database retrieval system