Myotis davidii (David's myotis): 102761051 Help Entry 102761051         CDS       T02992                                  Symbol CXCL8, IL8 Name (RefSeq) C-X-C motif chemokine ligand 8   KO K10030   interleukin 8 Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04061   Viral protein interaction with cytokine and cytokine receptor myd04062   Chemokine signaling pathway myd04064   NF-kappa B signaling pathway myd04072   Phospholipase D signaling pathway myd04218   Cellular senescence myd04620   Toll-like receptor signaling pathway myd04621   NOD-like receptor signaling pathway myd04622   RIG-I-like receptor signaling pathway myd04657   IL-17 signaling pathway myd04932   Non-alcoholic fatty liver disease myd04933   AGE-RAGE signaling pathway in diabetic complications myd04936   Alcoholic liver disease myd05132   Salmonella infection myd05133   Pertussis myd05134   Legionellosis myd05135   Yersinia infection myd05142   Chagas disease myd05144   Malaria myd05146   Amoebiasis myd05161   Hepatitis B myd05163   Human cytomegalovirus infection myd05164   Influenza A myd05167   Kaposi sarcoma-associated herpesvirus infection myd05171   Coronavirus disease - COVID-19 myd05200   Pathways in cancer myd05202   Transcriptional misregulation in cancer myd05219   Bladder cancer myd05323   Rheumatoid arthritis myd05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102761051 (CXCL8)    04072 Phospholipase D signaling pathway     102761051 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102761051 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102761051 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102761051 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102761051 (CXCL8)    04621 NOD-like receptor signaling pathway     102761051 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102761051 (CXCL8)    04657 IL-17 signaling pathway     102761051 (CXCL8)    04062 Chemokine signaling pathway     102761051 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102761051 (CXCL8)    05202 Transcriptional misregulation in cancer     102761051 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102761051 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102761051 (CXCL8)    05171 Coronavirus disease - COVID-19     102761051 (CXCL8)    05164 Influenza A     102761051 (CXCL8)    05163 Human cytomegalovirus infection     102761051 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102761051 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102761051 (CXCL8)    05135 Yersinia infection     102761051 (CXCL8)    05133 Pertussis     102761051 (CXCL8)    05134 Legionellosis     102761051 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102761051 (CXCL8)    05144 Malaria     102761051 (CXCL8)    05142 Chagas disease     102761051 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102761051 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102761051 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102761051 (CXCL8)    04932 Non-alcoholic fatty liver disease     102761051 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102761051 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102761051 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102761051 (CXCL8) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Chemokines    102761051 (CXCL8) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Chemokines    102761051 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Gp_UL130 Motif Other DBs NCBI-GeneID:  102761051 NCBI-ProteinID:  XP_006770712 LinkDB All DBs Position Un AA seq 101 aa AA seqDB search MASKLAVALLAAFVLSAALCEASVLPIIETELRCQCIGTHSTPFHPMLIRELRVIESGPH CANSEIIVKFKNETLLCLDPKEHWVQKVVQTFLETAETKEP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcttccaagctggccgtcgctctcctggcagcgttcgtgctttctgcagcgctgtgc gaagcttcagttctgccgataatagaaacagaacttcgatgccagtgcattggtacgcac tctacacctttccaccccatgcttatcagggaactgagagtgattgagagtggaccacac tgtgcaaattcagaaatcattgtaaagtttaagaatgaaacattgctctgcctggacccc aaggaacactgggtgcagaaggttgtgcagacatttttagagacagctgagacaaaagag ccatga

DBGET integrated database retrieval system