KEGG   Myotis davidii (David's myotis): 102761492
Entry
102761492         CDS       T02992                                 
Symbol
NRAS
Name
(RefSeq) neuroblastoma RAS viral oncogene homolog
  KO
K07828  GTPase NRas
Organism
myd  Myotis davidii (David's myotis)
Pathway
myd01521  EGFR tyrosine kinase inhibitor resistance
myd01522  Endocrine resistance
myd04010  MAPK signaling pathway
myd04012  ErbB signaling pathway
myd04014  Ras signaling pathway
myd04015  Rap1 signaling pathway
myd04062  Chemokine signaling pathway
myd04068  FoxO signaling pathway
myd04071  Sphingolipid signaling pathway
myd04072  Phospholipase D signaling pathway
myd04137  Mitophagy - animal
myd04140  Autophagy - animal
myd04150  mTOR signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04210  Apoptosis
myd04211  Longevity regulating pathway
myd04213  Longevity regulating pathway - multiple species
myd04218  Cellular senescence
myd04360  Axon guidance
myd04370  VEGF signaling pathway
myd04371  Apelin signaling pathway
myd04540  Gap junction
myd04550  Signaling pathways regulating pluripotency of stem cells
myd04625  C-type lectin receptor signaling pathway
myd04650  Natural killer cell mediated cytotoxicity
myd04660  T cell receptor signaling pathway
myd04662  B cell receptor signaling pathway
myd04664  Fc epsilon RI signaling pathway
myd04714  Thermogenesis
myd04720  Long-term potentiation
myd04722  Neurotrophin signaling pathway
myd04725  Cholinergic synapse
myd04726  Serotonergic synapse
myd04730  Long-term depression
myd04810  Regulation of actin cytoskeleton
myd04910  Insulin signaling pathway
myd04912  GnRH signaling pathway
myd04915  Estrogen signaling pathway
myd04916  Melanogenesis
myd04917  Prolactin signaling pathway
myd04919  Thyroid hormone signaling pathway
myd04921  Oxytocin signaling pathway
myd04926  Relaxin signaling pathway
myd04929  GnRH secretion
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd04935  Growth hormone synthesis, secretion and action
myd05010  Alzheimer disease
myd05022  Pathways of neurodegeneration - multiple diseases
myd05034  Alcoholism
myd05160  Hepatitis C
myd05161  Hepatitis B
myd05163  Human cytomegalovirus infection
myd05165  Human papillomavirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05170  Human immunodeficiency virus 1 infection
myd05200  Pathways in cancer
myd05203  Viral carcinogenesis
myd05205  Proteoglycans in cancer
myd05206  MicroRNAs in cancer
myd05207  Chemical carcinogenesis - receptor activation
myd05208  Chemical carcinogenesis - reactive oxygen species
myd05210  Colorectal cancer
myd05211  Renal cell carcinoma
myd05213  Endometrial cancer
myd05214  Glioma
myd05215  Prostate cancer
myd05216  Thyroid cancer
myd05218  Melanoma
myd05219  Bladder cancer
myd05220  Chronic myeloid leukemia
myd05221  Acute myeloid leukemia
myd05223  Non-small cell lung cancer
myd05224  Breast cancer
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
myd05230  Central carbon metabolism in cancer
myd05231  Choline metabolism in cancer
myd05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myd05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102761492 (NRAS)
   04012 ErbB signaling pathway
    102761492 (NRAS)
   04014 Ras signaling pathway
    102761492 (NRAS)
   04015 Rap1 signaling pathway
    102761492 (NRAS)
   04370 VEGF signaling pathway
    102761492 (NRAS)
   04371 Apelin signaling pathway
    102761492 (NRAS)
   04068 FoxO signaling pathway
    102761492 (NRAS)
   04072 Phospholipase D signaling pathway
    102761492 (NRAS)
   04071 Sphingolipid signaling pathway
    102761492 (NRAS)
   04151 PI3K-Akt signaling pathway
    102761492 (NRAS)
   04150 mTOR signaling pathway
    102761492 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102761492 (NRAS)
   04137 Mitophagy - animal
    102761492 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102761492 (NRAS)
   04218 Cellular senescence
    102761492 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102761492 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102761492 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102761492 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102761492 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102761492 (NRAS)
   04660 T cell receptor signaling pathway
    102761492 (NRAS)
   04662 B cell receptor signaling pathway
    102761492 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102761492 (NRAS)
   04062 Chemokine signaling pathway
    102761492 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102761492 (NRAS)
   04929 GnRH secretion
    102761492 (NRAS)
   04912 GnRH signaling pathway
    102761492 (NRAS)
   04915 Estrogen signaling pathway
    102761492 (NRAS)
   04917 Prolactin signaling pathway
    102761492 (NRAS)
   04921 Oxytocin signaling pathway
    102761492 (NRAS)
   04926 Relaxin signaling pathway
    102761492 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102761492 (NRAS)
   04919 Thyroid hormone signaling pathway
    102761492 (NRAS)
   04916 Melanogenesis
    102761492 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102761492 (NRAS)
   04726 Serotonergic synapse
    102761492 (NRAS)
   04720 Long-term potentiation
    102761492 (NRAS)
   04730 Long-term depression
    102761492 (NRAS)
   04722 Neurotrophin signaling pathway
    102761492 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102761492 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102761492 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102761492 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102761492 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102761492 (NRAS)
   05206 MicroRNAs in cancer
    102761492 (NRAS)
   05205 Proteoglycans in cancer
    102761492 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    102761492 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102761492 (NRAS)
   05203 Viral carcinogenesis
    102761492 (NRAS)
   05230 Central carbon metabolism in cancer
    102761492 (NRAS)
   05231 Choline metabolism in cancer
    102761492 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102761492 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102761492 (NRAS)
   05225 Hepatocellular carcinoma
    102761492 (NRAS)
   05226 Gastric cancer
    102761492 (NRAS)
   05214 Glioma
    102761492 (NRAS)
   05216 Thyroid cancer
    102761492 (NRAS)
   05221 Acute myeloid leukemia
    102761492 (NRAS)
   05220 Chronic myeloid leukemia
    102761492 (NRAS)
   05218 Melanoma
    102761492 (NRAS)
   05211 Renal cell carcinoma
    102761492 (NRAS)
   05219 Bladder cancer
    102761492 (NRAS)
   05215 Prostate cancer
    102761492 (NRAS)
   05213 Endometrial cancer
    102761492 (NRAS)
   05224 Breast cancer
    102761492 (NRAS)
   05223 Non-small cell lung cancer
    102761492 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102761492 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102761492 (NRAS)
   05161 Hepatitis B
    102761492 (NRAS)
   05160 Hepatitis C
    102761492 (NRAS)
   05163 Human cytomegalovirus infection
    102761492 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102761492 (NRAS)
   05165 Human papillomavirus infection
    102761492 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102761492 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102761492 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102761492 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102761492 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102761492 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102761492 (NRAS)
   01522 Endocrine resistance
    102761492 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myd04131]
    102761492 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myd04147]
    102761492 (NRAS)
   04031 GTP-binding proteins [BR:myd04031]
    102761492 (NRAS)
Membrane trafficking [BR:myd04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102761492 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102761492 (NRAS)
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102761492 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102761492 (NRAS)
  Exosomal proteins of breast cancer cells
   102761492 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102761492 (NRAS)
GTP-binding proteins [BR:myd04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102761492 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 102761492
NCBI-ProteinID: XP_006763104
UniProt: L5LXT3
LinkDB
Position
Un
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca
atccagctaatccagaaccactttgtagacgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctattggatatactggatacagctgga
caagaggagtacagtgctatgagggaccaatacatgaggacaggggaaggcttcctctgt
gtattcgccatcaataatagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtgaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactagta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system