KEGG   Myotis davidii (David's myotis): 102762537
Entry
102762537         CDS       T02992                                 
Symbol
HRAS
Name
(RefSeq) HRas proto-oncogene, GTPase
  KO
K02833  GTPase HRas
Organism
myd  Myotis davidii (David's myotis)
Pathway
myd01521  EGFR tyrosine kinase inhibitor resistance
myd01522  Endocrine resistance
myd04010  MAPK signaling pathway
myd04012  ErbB signaling pathway
myd04014  Ras signaling pathway
myd04015  Rap1 signaling pathway
myd04062  Chemokine signaling pathway
myd04068  FoxO signaling pathway
myd04071  Sphingolipid signaling pathway
myd04072  Phospholipase D signaling pathway
myd04137  Mitophagy - animal
myd04140  Autophagy - animal
myd04144  Endocytosis
myd04150  mTOR signaling pathway
myd04151  PI3K-Akt signaling pathway
myd04210  Apoptosis
myd04211  Longevity regulating pathway
myd04213  Longevity regulating pathway - multiple species
myd04218  Cellular senescence
myd04360  Axon guidance
myd04370  VEGF signaling pathway
myd04371  Apelin signaling pathway
myd04510  Focal adhesion
myd04540  Gap junction
myd04550  Signaling pathways regulating pluripotency of stem cells
myd04625  C-type lectin receptor signaling pathway
myd04630  JAK-STAT signaling pathway
myd04650  Natural killer cell mediated cytotoxicity
myd04660  T cell receptor signaling pathway
myd04662  B cell receptor signaling pathway
myd04664  Fc epsilon RI signaling pathway
myd04714  Thermogenesis
myd04720  Long-term potentiation
myd04722  Neurotrophin signaling pathway
myd04725  Cholinergic synapse
myd04726  Serotonergic synapse
myd04730  Long-term depression
myd04810  Regulation of actin cytoskeleton
myd04910  Insulin signaling pathway
myd04912  GnRH signaling pathway
myd04915  Estrogen signaling pathway
myd04916  Melanogenesis
myd04917  Prolactin signaling pathway
myd04919  Thyroid hormone signaling pathway
myd04921  Oxytocin signaling pathway
myd04926  Relaxin signaling pathway
myd04929  GnRH secretion
myd04933  AGE-RAGE signaling pathway in diabetic complications
myd04935  Growth hormone synthesis, secretion and action
myd05010  Alzheimer disease
myd05022  Pathways of neurodegeneration - multiple diseases
myd05034  Alcoholism
myd05132  Salmonella infection
myd05160  Hepatitis C
myd05161  Hepatitis B
myd05163  Human cytomegalovirus infection
myd05165  Human papillomavirus infection
myd05166  Human T-cell leukemia virus 1 infection
myd05167  Kaposi sarcoma-associated herpesvirus infection
myd05170  Human immunodeficiency virus 1 infection
myd05200  Pathways in cancer
myd05203  Viral carcinogenesis
myd05205  Proteoglycans in cancer
myd05206  MicroRNAs in cancer
myd05207  Chemical carcinogenesis - receptor activation
myd05208  Chemical carcinogenesis - reactive oxygen species
myd05210  Colorectal cancer
myd05211  Renal cell carcinoma
myd05213  Endometrial cancer
myd05214  Glioma
myd05215  Prostate cancer
myd05216  Thyroid cancer
myd05218  Melanoma
myd05219  Bladder cancer
myd05220  Chronic myeloid leukemia
myd05221  Acute myeloid leukemia
myd05223  Non-small cell lung cancer
myd05224  Breast cancer
myd05225  Hepatocellular carcinoma
myd05226  Gastric cancer
myd05230  Central carbon metabolism in cancer
myd05231  Choline metabolism in cancer
myd05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
myd05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:myd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102762537 (HRAS)
   04012 ErbB signaling pathway
    102762537 (HRAS)
   04014 Ras signaling pathway
    102762537 (HRAS)
   04015 Rap1 signaling pathway
    102762537 (HRAS)
   04370 VEGF signaling pathway
    102762537 (HRAS)
   04371 Apelin signaling pathway
    102762537 (HRAS)
   04630 JAK-STAT signaling pathway
    102762537 (HRAS)
   04068 FoxO signaling pathway
    102762537 (HRAS)
   04072 Phospholipase D signaling pathway
    102762537 (HRAS)
   04071 Sphingolipid signaling pathway
    102762537 (HRAS)
   04151 PI3K-Akt signaling pathway
    102762537 (HRAS)
   04150 mTOR signaling pathway
    102762537 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102762537 (HRAS)
   04140 Autophagy - animal
    102762537 (HRAS)
   04137 Mitophagy - animal
    102762537 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102762537 (HRAS)
   04218 Cellular senescence
    102762537 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102762537 (HRAS)
   04540 Gap junction
    102762537 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102762537 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102762537 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102762537 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    102762537 (HRAS)
   04660 T cell receptor signaling pathway
    102762537 (HRAS)
   04662 B cell receptor signaling pathway
    102762537 (HRAS)
   04664 Fc epsilon RI signaling pathway
    102762537 (HRAS)
   04062 Chemokine signaling pathway
    102762537 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102762537 (HRAS)
   04929 GnRH secretion
    102762537 (HRAS)
   04912 GnRH signaling pathway
    102762537 (HRAS)
   04915 Estrogen signaling pathway
    102762537 (HRAS)
   04917 Prolactin signaling pathway
    102762537 (HRAS)
   04921 Oxytocin signaling pathway
    102762537 (HRAS)
   04926 Relaxin signaling pathway
    102762537 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    102762537 (HRAS)
   04919 Thyroid hormone signaling pathway
    102762537 (HRAS)
   04916 Melanogenesis
    102762537 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102762537 (HRAS)
   04726 Serotonergic synapse
    102762537 (HRAS)
   04720 Long-term potentiation
    102762537 (HRAS)
   04730 Long-term depression
    102762537 (HRAS)
   04722 Neurotrophin signaling pathway
    102762537 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102762537 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102762537 (HRAS)
   04213 Longevity regulating pathway - multiple species
    102762537 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102762537 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102762537 (HRAS)
   05206 MicroRNAs in cancer
    102762537 (HRAS)
   05205 Proteoglycans in cancer
    102762537 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    102762537 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102762537 (HRAS)
   05203 Viral carcinogenesis
    102762537 (HRAS)
   05230 Central carbon metabolism in cancer
    102762537 (HRAS)
   05231 Choline metabolism in cancer
    102762537 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102762537 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102762537 (HRAS)
   05225 Hepatocellular carcinoma
    102762537 (HRAS)
   05226 Gastric cancer
    102762537 (HRAS)
   05214 Glioma
    102762537 (HRAS)
   05216 Thyroid cancer
    102762537 (HRAS)
   05221 Acute myeloid leukemia
    102762537 (HRAS)
   05220 Chronic myeloid leukemia
    102762537 (HRAS)
   05218 Melanoma
    102762537 (HRAS)
   05211 Renal cell carcinoma
    102762537 (HRAS)
   05219 Bladder cancer
    102762537 (HRAS)
   05215 Prostate cancer
    102762537 (HRAS)
   05213 Endometrial cancer
    102762537 (HRAS)
   05224 Breast cancer
    102762537 (HRAS)
   05223 Non-small cell lung cancer
    102762537 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102762537 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    102762537 (HRAS)
   05161 Hepatitis B
    102762537 (HRAS)
   05160 Hepatitis C
    102762537 (HRAS)
   05163 Human cytomegalovirus infection
    102762537 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102762537 (HRAS)
   05165 Human papillomavirus infection
    102762537 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102762537 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102762537 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102762537 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    102762537 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102762537 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102762537 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102762537 (HRAS)
   01522 Endocrine resistance
    102762537 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:myd04131]
    102762537 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myd04147]
    102762537 (HRAS)
   04031 GTP-binding proteins [BR:myd04031]
    102762537 (HRAS)
Membrane trafficking [BR:myd04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102762537 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102762537 (HRAS)
Exosome [BR:myd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102762537 (HRAS)
  Exosomal proteins of colorectal cancer cells
   102762537 (HRAS)
GTP-binding proteins [BR:myd04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102762537 (HRAS)
SSDB
Motif
Pfam: Ras Roc MMR_HSR1 Arf GTP_EFTU Septin AAA_16
Other DBs
NCBI-GeneID: 102762537
NCBI-ProteinID: XP_015417881
LinkDB
Position
Un
AA seq 180 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYRLARAPPRPPREPCSLPLSLHTGQ
PLWPWLWLQLRDPHDPAAPRAGVEDAFYTLVREIRQHKVRKLSPPDEGGPGCMSCKCLLS
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaccgagtacaagctggtggtggtgggggccggaggtgtggggaagagcgccctgacc
atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcctac
cggaagcaagtggtcattgacggggagacgtgtctgctggacattctggacacggcgggc
caggaggagtacagtgccatgcgggaccagtacatgcgcaccggggagggcttcctctgt
gtgttcgccatcaacaacaccaagtccttcgaggacatccaccagtaccggctagccagg
gccccgccccgcccccccagggagccttgctcattgcccctctccctccacacagggcag
ccgctctggccctggctctggctccagctccgggacccccatgacccagctgcccctcgc
gctggcgtggaggacgccttctacacgctggtgcgtgagatccggcagcacaaggtgcgc
aagctgagcccgccggacgagggcggccctggctgcatgagctgcaagtgcctgctctcc
tga

DBGET integrated database retrieval system