Myotis davidii (David's myotis): 102762870 Help Entry 102762870         CDS       T02992                                  Symbol S100A10 Name (RefSeq) S100 calcium binding protein A10   KO K17274   protein S100-A10 Organism myd  Myotis davidii (David's myotis) Pathway myd04382   Cornified envelope formation myd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myd00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102762870 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102762870 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myd04147]     102762870 (S100A10) Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of microglial cells    102762870 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  102762870 NCBI-ProteinID:  XP_006755780 LinkDB All DBs Position Un AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacgtttcataagtttgct ggggataaaggctacttaacaaaggaggacctaagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggctgtagacaagataatgaaggacctggac cagtgccgagacggcagagttggcttccagagcttcttttcgctaattgctgggctcacc atcgcatgcaatgactatttcgtagtacacatgaagcagaagggaaggaagtga

DBGET integrated database retrieval system