Myotis davidii (David's myotis): 102763022 Help Entry 102763022         CDS       T02992                                  Symbol SEC61G Name (RefSeq) Sec61 translocon gamma subunit   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism myd  Myotis davidii (David's myotis) Pathway myd03060   Protein export myd04141   Protein processing in endoplasmic reticulum myd04145   Phagosome Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     102763022 (SEC61G)    04141 Protein processing in endoplasmic reticulum     102763022 (SEC61G)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102763022 (SEC61G)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myd04131]     102763022 (SEC61G)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:myd02044]     102763022 (SEC61G) Membrane trafficking [BR:myd04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     102763022 (SEC61G) Secretion system [BR:myd02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    102763022 (SEC61G) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Pho88 Motif Other DBs NCBI-GeneID:  102763022 NCBI-ProteinID:  XP_006764927 LinkDB All DBs Position Un AA seq 68 aa AA seqDB search MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP INNIIVGG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaccaggtcatgcagttcgtggagccaagtcggcagtttgtgaaggattccatccgg ctggtcaagagatgcaccaaacccgacagaaaagaattccagaagattgccatggcgaca gcaatcggatttgctataatgggtttcattggcttttttgtgaaattgatccatatccct attaataacatcattgttggtggctga

DBGET integrated database retrieval system