Myotis davidii (David's myotis): 102763588
Help
Entry
102763588 CDS
T02992
Symbol
PSMD7
Name
(RefSeq) proteasome 26S subunit, non-ATPase 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
myd
Myotis davidii (David's myotis)
Pathway
myd03050
Proteasome
myd05010
Alzheimer disease
myd05012
Parkinson disease
myd05014
Amyotrophic lateral sclerosis
myd05016
Huntington disease
myd05017
Spinocerebellar ataxia
myd05020
Prion disease
myd05022
Pathways of neurodegeneration - multiple diseases
myd05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
myd00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
102763588 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
102763588 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
102763588 (PSMD7)
05012 Parkinson disease
102763588 (PSMD7)
05014 Amyotrophic lateral sclerosis
102763588 (PSMD7)
05016 Huntington disease
102763588 (PSMD7)
05017 Spinocerebellar ataxia
102763588 (PSMD7)
05020 Prion disease
102763588 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
102763588 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
myd03051
]
102763588 (PSMD7)
Proteasome [BR:
myd03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
102763588 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
JAB
MitMem_reg
Motif
Other DBs
NCBI-GeneID:
102763588
NCBI-ProteinID:
XP_006760402
LinkDB
All DBs
Position
Un
AA seq
298 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLPADHKPGAWFEGTELQTSGYQRLPGESGYRQASHQPPDHLPAAGCLQPAARCE
PAGVCQGLLPKDQRPDGRGVFGLLDPFSGCPAQPHQQQDCQPGCREKRRAGKRREQKG
NT seq
897 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccatcccctggtgctgctcagtgtggtg
gatcattttaaccgaataggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtactggatgtatctaacagttttgcagtcccttttgatgaa
gatgacaaagatgattccgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttggatggtaccacacaggccctaaa
ctacataagaatgacatcgccatcaatgaactcatgaaaagatactgccctaactcagta
ttagtcatcattgatgtgaaaccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagttcatgatgatggaactccaacctcaaaaacatttgagcacgtgaccagt
gaaattggagcagaggaagctgaagaagttggggtcgaacacttgttacgagacatcaaa
gacactactgtgggcactctcccagcggatcacaagccaggtgcatggtttgaagggact
gaactccaaacttctggatatcaaaggctacctggagaaagtggctacaggcaagcttcc
catcaaccaccagatcatctaccagctgcaggatgtcttcaacctgctgccagatgtgag
cctgcaggagtttgtcaaggccttttacctaaagaccaacgaccagatggtcgtggtgta
tttggcctccttgatccgttcagtggttgccctgcacaacctcatcaacaacaagattgc
caaccgggatgcagagaaaaaagaagggcaggaaaaagaagagagcaaaaaggatag
DBGET
integrated database retrieval system