Myotis davidii (David's myotis): 102763778 Help Entry 102763778         CDS       T02992                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism myd  Myotis davidii (David's myotis) Pathway myd04613   Neutrophil extracellular trap formation myd05034   Alcoholism myd05202   Transcriptional misregulation in cancer myd05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:myd00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102763778  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102763778   09163 Immune disease    05322 Systemic lupus erythematosus     102763778   09165 Substance dependence    05034 Alcoholism     102763778  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myd03036]     102763778   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myd04147]     102763778 Chromosome and associated proteins [BR:myd03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102763778 Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102763778 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  102763778 NCBI-ProteinID:  XP_006760038 UniProt:  L5M3X4 LinkDB All DBs Position Un AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagacggcgcgcaagtcgacgggcgggaaggcgccccgcaagcag ctggccaccaaggccgcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcaccgtggccctgcgcgagatccggcgctaccagaagtccacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctgttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctcgcgcgccgcatccgcggcgagagggcgtaa

DBGET integrated database retrieval system