Myotis davidii (David's myotis): 102764877 Help Entry 102764877         CDS       T02992                                  Symbol WNT1 Name (RefSeq) Wnt family member 1   KO K03209   wingless-type MMTV integration site family, member 1 Organism myd  Myotis davidii (David's myotis) Pathway myd04150   mTOR signaling pathway myd04310   Wnt signaling pathway myd04390   Hippo signaling pathway myd04550   Signaling pathways regulating pluripotency of stem cells myd04916   Melanogenesis myd04934   Cushing syndrome myd05010   Alzheimer disease myd05022   Pathways of neurodegeneration - multiple diseases myd05165   Human papillomavirus infection myd05200   Pathways in cancer myd05205   Proteoglycans in cancer myd05207   Chemical carcinogenesis - receptor activation myd05217   Basal cell carcinoma myd05224   Breast cancer myd05225   Hepatocellular carcinoma myd05226   Gastric cancer Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102764877 (WNT1)    04390 Hippo signaling pathway     102764877 (WNT1)    04150 mTOR signaling pathway     102764877 (WNT1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102764877 (WNT1)  09150 Organismal Systems   09152 Endocrine system    04916 Melanogenesis     102764877 (WNT1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102764877 (WNT1)    05205 Proteoglycans in cancer     102764877 (WNT1)    05207 Chemical carcinogenesis - receptor activation     102764877 (WNT1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102764877 (WNT1)    05226 Gastric cancer     102764877 (WNT1)    05217 Basal cell carcinoma     102764877 (WNT1)    05224 Breast cancer     102764877 (WNT1)   09172 Infectious disease: viral    05165 Human papillomavirus infection     102764877 (WNT1)   09164 Neurodegenerative disease    05010 Alzheimer disease     102764877 (WNT1)    05022 Pathways of neurodegeneration - multiple diseases     102764877 (WNT1)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102764877 (WNT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102764877 (WNT1) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Morphogens    102764877 (WNT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  wnt Motif Other DBs NCBI-GeneID:  102764877 NCBI-ProteinID:  XP_006755626 LinkDB All DBs Position Un AA seq 215 aa AA seqDB search MGHWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF GREFVDSGEKGRDLRFLMNLHNNEAGRTLKQEVPG NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggggcactgggcgctgctgcccggctgggtttctgctacactgttgctggcgctggcc gctctgcctgcagctctggccgccaacagcagtggccgatggtggggcatcgtgaacgta gcctcctccacgaacctactgaccgactccaagagcctgcagctggtgctggagcccagt ctgcagctgctgagccgcaagcagcggcggctgatccgccagaacccggggatcctgcac agtgtgagtggggggctgcagagcgctgtgcgcgagtgcaagtggcagttccggaaccgc cgctggaactgccccacggcttcggggccccacctcttcggcaagatcgtcaaccgaggc tgtcgggaaacagcatttatcttcgcgatcacctctgctggggtcacccactcggtggct cgctcctgctccgagggctccatcgagtcctgcacgtgcgactaccggcgacgcgggcct gggggccccgattggcactggggaggctgcagcgacaacatcgacttcggtcgcctcttc ggccgggagtttgtggattccggggagaaggggcgggacctgcgcttcctcatgaacctt cacaacaacgaggcgggccgaacgctgaagcaggaggtgccggggtga

DBGET integrated database retrieval system