Myotis davidii (David's myotis): 102764924 Help Entry 102764924         CDS       T02992                                  Symbol FABP1 Name (RefSeq) fatty acid binding protein 1   KO K08750   fatty acid-binding protein 1, liver Organism myd  Myotis davidii (David's myotis) Pathway myd03320   PPAR signaling pathway myd04936   Alcoholic liver disease myd04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:myd00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     102764924 (FABP1)   09154 Digestive system    04975 Fat digestion and absorption     102764924 (FABP1)  09160 Human Diseases   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102764924 (FABP1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lipocalin_7 Lipocalin gp32 Glyco_hydro_42M Motif Other DBs NCBI-GeneID:  102764924 NCBI-ProteinID:  XP_006764071 LinkDB All DBs Position Un AA seq 119 aa AA seqDB search MNFSGKYQLQSQENFEPFMKAIGLPDDLIQKGKDIKGVSEVVQNGKHFKLTVTTGSKVIQ NEFTLGEECELETMTGEKVKAVVQLEGENKLVTSFKGIKSVTELNGDTVIHLFVSAATS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaatttctccggcaagtaccagctgcagagccaggaaaactttgagcccttcatgaag gcaattggtctgcctgacgacctcatccagaaggggaaggacatcaagggagtgtcggaa gtcgtgcagaatgggaagcacttcaagctcaccgtcaccaccgggtccaaagtgatccag aacgagttcaccctgggggaggagtgcgagctggagaccatgactggggagaaggtcaag gcagtggtgcagctggaaggtgagaataaactggtgacatctttcaaaggcatcaagtcc gtgacagaactcaatggagacacagtcatccacctgttcgtctctgctgccacctcctga

DBGET integrated database retrieval system