Myotis davidii (David's myotis): 102764949 Help Entry 102764949         CDS       T02992                                  Symbol BAK1 Name (RefSeq) BCL2 antagonist/killer 1   KO K14021   Bcl-2 homologous antagonist/killer Organism myd  Myotis davidii (David's myotis) Pathway myd01524   Platinum drug resistance myd04141   Protein processing in endoplasmic reticulum myd04210   Apoptosis myd04215   Apoptosis - multiple species myd05022   Pathways of neurodegeneration - multiple diseases myd05132   Salmonella infection myd05160   Hepatitis C myd05162   Measles myd05163   Human cytomegalovirus infection myd05164   Influenza A myd05165   Human papillomavirus infection myd05167   Kaposi sarcoma-associated herpesvirus infection myd05168   Herpes simplex virus 1 infection myd05169   Epstein-Barr virus infection myd05170   Human immunodeficiency virus 1 infection myd05200   Pathways in cancer myd05202   Transcriptional misregulation in cancer myd05203   Viral carcinogenesis myd05206   MicroRNAs in cancer myd05210   Colorectal cancer myd05212   Pancreatic cancer myd05213   Endometrial cancer myd05214   Glioma myd05216   Thyroid cancer myd05217   Basal cell carcinoma myd05218   Melanoma myd05220   Chronic myeloid leukemia myd05222   Small cell lung cancer myd05223   Non-small cell lung cancer myd05224   Breast cancer myd05225   Hepatocellular carcinoma myd05226   Gastric cancer Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102764949 (BAK1)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102764949 (BAK1)    04215 Apoptosis - multiple species     102764949 (BAK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102764949 (BAK1)    05202 Transcriptional misregulation in cancer     102764949 (BAK1)    05206 MicroRNAs in cancer     102764949 (BAK1)    05203 Viral carcinogenesis     102764949 (BAK1)   09162 Cancer: specific types    05210 Colorectal cancer     102764949 (BAK1)    05212 Pancreatic cancer     102764949 (BAK1)    05225 Hepatocellular carcinoma     102764949 (BAK1)    05226 Gastric cancer     102764949 (BAK1)    05214 Glioma     102764949 (BAK1)    05216 Thyroid cancer     102764949 (BAK1)    05220 Chronic myeloid leukemia     102764949 (BAK1)    05217 Basal cell carcinoma     102764949 (BAK1)    05218 Melanoma     102764949 (BAK1)    05213 Endometrial cancer     102764949 (BAK1)    05224 Breast cancer     102764949 (BAK1)    05222 Small cell lung cancer     102764949 (BAK1)    05223 Non-small cell lung cancer     102764949 (BAK1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102764949 (BAK1)    05160 Hepatitis C     102764949 (BAK1)    05164 Influenza A     102764949 (BAK1)    05162 Measles     102764949 (BAK1)    05168 Herpes simplex virus 1 infection     102764949 (BAK1)    05163 Human cytomegalovirus infection     102764949 (BAK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102764949 (BAK1)    05169 Epstein-Barr virus infection     102764949 (BAK1)    05165 Human papillomavirus infection     102764949 (BAK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102764949 (BAK1)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     102764949 (BAK1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102764949 (BAK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:myd03029]     102764949 (BAK1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:myd02000]     102764949 (BAK1) Mitochondrial biogenesis [BR:myd03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     102764949 (BAK1) Transporters [BR:myd02000]  Other transporters   Pores ion channels [TC:1]    102764949 (BAK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Motif Other DBs NCBI-GeneID:  102764949 NCBI-ProteinID:  XP_015422946 LinkDB All DBs Position Un AA seq 224 aa AA seqDB search MASGQGPGPPRQDCEGPAPASTSEEQVARDTEEVFRSYVFYRHQQEQEAEAAVPPDPEMV TLSPEPASTLGQVGRQLAIIGDDINQRFDLEFHTMLQHLQPTPENAYQYFTKIASRPAAM PTGNLPAASVHCSALCPLRPQHRAPGGGGGGGSPILCPLSFLLSQSCRLSPNSSQAGTSA TGHPPSISWQVAALDLGNGPIRNVLIVLAVVLLGQFVVRRFFQS NT seq 675 nt NT seq  +upstreamnt  +downstreamnt atggcatctgggcaaggaccgggcccgcccaggcaggactgtgaagggcctgccccagcc tccacttcggaggagcaggtggcccgggacacagaggaggttttccgcagctacgttttt taccgccatcagcaggagcaggaagctgaggcggctgtcccccctgacccagagatggtc accttgtccccagagcctgccagcaccttggggcaggtgggccggcagctcgccatcatc ggggacgacatcaaccagcgcttcgacctggagttccacaccatgttgcagcacctgcag ccgaccccagagaacgcctaccagtacttcaccaagatcgcctccaggccagcagcaatg cccacaggtaatctccccgctgcctctgtccactgctctgccctgtgccccctgcgcccg cagcaccgggcccccggcggtggtggcggcggcggcagtcccatcctgtgccctctgagc tttctcctttcacagagttgcaggctctccccaaacagcagccaggcgggcacctctgcc accggacaccctccctccatctcctggcaggtggcagccctggacctgggcaacggcccc atccggaatgtgctgatagttctggctgtggttctgttgggccagtttgtggtacgaaga ttcttccagtcatga

DBGET integrated database retrieval system