Myotis davidii (David's myotis): 102765189 Help Entry 102765189         CDS       T02992                                  Symbol PFN2, Profilin-2 Name (RefSeq) profilin 2   KO K05759   profilin Organism myd  Myotis davidii (David's myotis) Pathway myd04015   Rap1 signaling pathway myd04810   Regulation of actin cytoskeleton myd05014   Amyotrophic lateral sclerosis myd05132   Salmonella infection Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102765189 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102765189 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102765189 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102765189 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myd04131]     102765189 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:myd04812]     102765189 (PFN2)    04147 Exosome [BR:myd04147]     102765189 (PFN2) Membrane trafficking [BR:myd04131]  Others   Actin-binding proteins    Others     102765189 (PFN2) Cytoskeleton proteins [BR:myd04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102765189 (PFN2) Exosome [BR:myd04147]  Exosomal proteins   Proteins found in most exosomes    102765189 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102765189 NCBI-ProteinID:  XP_015416371 LinkDB All DBs Position Un AA seq 101 aa AA seqDB search MYTDNPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTY NVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtacaccgacaacccagtagaaatagatatgattgtaggaaaagatcgggaaggtttc tttaccaacggtttgactcttggcgcaaagaagtgctcagtgatcagagacagtctgtat gtggatggtgactgcacaatggacatcaggacaaagagtcaaggtggggagccaacatac aacgttgcagtgggcagagctggcagagtcttggtctttgtaatgggaaaagaaggggtc catggaggcggcttgaataagaaggcatactcaatggcaaaatacttgagagactctggg ttctag

DBGET integrated database retrieval system