Myotis davidii (David's myotis): 102765361 Help Entry 102765361         CDS       T02992                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04061   Viral protein interaction with cytokine and cytokine receptor myd04062   Chemokine signaling pathway myd04620   Toll-like receptor signaling pathway myd05142   Chagas disease myd05163   Human cytomegalovirus infection myd05323   Rheumatoid arthritis myd05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102765361    04061 Viral protein interaction with cytokine and cytokine receptor     102765361  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102765361    04062 Chemokine signaling pathway     102765361  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102765361   09174 Infectious disease: parasitic    05142 Chagas disease     102765361   09163 Immune disease    05323 Rheumatoid arthritis     102765361   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102765361  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102765361    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102765361 Cytokines and neuropeptides [BR:myd04052]  Cytokines   Chemokines    102765361 Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Chemokines    102765361 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102765361 NCBI-ProteinID:  XP_006756468 UniProt:  L5MBH4 LinkDB All DBs Position Un AA seq 93 aa AA seqDB search MKVSGAALAVLLCTMALCSQVLSAPAGADTPTACCFTYAPRQIPRTYIVDYFETSSQCSK PGVIFQTRRGRQVCANPSEDWVQEYVTNLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccggggctgccctggccgtcctcctctgcaccatggccctctgcagccag gtcttgtctgcaccagctggtgctgacaccccgaccgcctgctgcttcacctatgcgcct cggcagattccacgcacatacattgtcgactattttgagaccagcagccagtgttccaag ccaggtgttatcttccaaaccagaagaggccggcaggtctgtgccaaccccagtgaggac tgggtccaggaatacgtcaccaacctggagctgaatgcctga

DBGET integrated database retrieval system