Myotis davidii (David's myotis): 102765865 Help Entry 102765865         CDS       T02992                                  Symbol IL5 Name (RefSeq) interleukin 5   KO K05428   interleukin 5 Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04630   JAK-STAT signaling pathway myd04640   Hematopoietic cell lineage myd04657   IL-17 signaling pathway myd04658   Th1 and Th2 cell differentiation myd04660   T cell receptor signaling pathway myd04664   Fc epsilon RI signaling pathway myd04672   Intestinal immune network for IgA production myd05200   Pathways in cancer myd05310   Asthma myd05320   Autoimmune thyroid disease myd05321   Inflammatory bowel disease myd05330   Allograft rejection Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102765865 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102765865 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102765865 (IL5)    04660 T cell receptor signaling pathway     102765865 (IL5)    04658 Th1 and Th2 cell differentiation     102765865 (IL5)    04657 IL-17 signaling pathway     102765865 (IL5)    04664 Fc epsilon RI signaling pathway     102765865 (IL5)    04672 Intestinal immune network for IgA production     102765865 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102765865 (IL5)   09163 Immune disease    05310 Asthma     102765865 (IL5)    05320 Autoimmune thyroid disease     102765865 (IL5)    05321 Inflammatory bowel disease     102765865 (IL5)    05330 Allograft rejection     102765865 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102765865 (IL5)    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102765865 (IL5) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Interleukins    102765865 (IL5) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Cytokines    102765865 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  102765865 NCBI-ProteinID:  XP_006759217 LinkDB All DBs Position Un AA seq 213 aa AA seqDB search MFLKGEKQGFLLLKDKSKLVFLRHKALETLVSQHAIIRQPLSDCWKLFISSKRENKLVGD TILYNALSLPKAFAEHFRATRMLLLLTFLALGAADVGAIALESPLKRLVAETLTLLSTHR TLLIGEGNLMIPTPGHTNYQLCIKEVFQGVDTLRNQTAEGDAVEKLFQNLSSIKDYIDGE KKKCEGERLRVKKFLDYLQVFLGVINTEWTMES NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atgtttttgaagggggaaaaacagggatttttattattaaaagataaaagtaaacttgtt tttttaagacacaaggcattggaaacattggtttcacaacatgccattattagacagcct ctatctgattgttggaaattattcatttcctcaaagagagagaataaattggttggggat acaatcttgtacaatgcactttctttgccaaaggcattcgctgaacatttcagagccacc agaatgcttctgcttttgactttcctggccctcggagctgccgacgttggtgccattgcc ttagaaagtccgttgaagagactggtggcagagaccttgaccctgctctccactcatcgg actctgctgataggcgaagggaacctgatgattcctactccgggacatacaaattaccaa ctatgcattaaagaagtctttcagggggtagacacattgaggaatcaaactgcagaaggg gatgccgtggaaaaactcttccagaacttgtcttcaataaaagactacatagatggcgaa aaaaaaaagtgtgaaggggaacgcttgagagtaaagaagttcctagactacctgcaagta tttcttggcgtgataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system