Myotis davidii (David's myotis): 102765937 Help Entry 102765937         CDS       T02992                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine ligand 5   KO K12499   C-C motif chemokine 5 Organism myd  Myotis davidii (David's myotis) Pathway myd04060   Cytokine-cytokine receptor interaction myd04061   Viral protein interaction with cytokine and cytokine receptor myd04062   Chemokine signaling pathway myd04620   Toll-like receptor signaling pathway myd04621   NOD-like receptor signaling pathway myd04623   Cytosolic DNA-sensing pathway myd04668   TNF signaling pathway myd05020   Prion disease myd05142   Chagas disease myd05163   Human cytomegalovirus infection myd05164   Influenza A myd05168   Herpes simplex virus 1 infection myd05323   Rheumatoid arthritis myd05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102765937 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102765937 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102765937 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102765937 (CCL5)    04621 NOD-like receptor signaling pathway     102765937 (CCL5)    04623 Cytosolic DNA-sensing pathway     102765937 (CCL5)    04062 Chemokine signaling pathway     102765937 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102765937 (CCL5)    05168 Herpes simplex virus 1 infection     102765937 (CCL5)    05163 Human cytomegalovirus infection     102765937 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102765937 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102765937 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102765937 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102765937 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102765937 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:myd00536]     102765937 (CCL5) Cytokines and neuropeptides [BR:myd04052]  Cytokines   Chemokines    102765937 (CCL5) Glycosaminoglycan binding proteins [BR:myd00536]  Heparan sulfate / Heparin   Chemokines    102765937 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Hydrolase_4 Motif Other DBs NCBI-GeneID:  102765937 NCBI-ProteinID:  XP_006756470 UniProt:  L5MAV1 LinkDB All DBs Position Un AA seq 91 aa AA seqDB search MKVSAAAFAVLLAAAAFCAPASASPYASDTTPCCFAYISRPLPRAHLKEYFYTSSKCSMP AVVLITRKNRQVCANPEKRWVREIINALEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagctgccttcgctgtcctcctcgccgcagccgccttctgtgctcct gcatcagcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc ccactgccccgtgcccacctcaaggagtatttctacaccagcagcaagtgctccatgcca gcagtcgtcttaatcacccgaaagaaccgtcaggtgtgtgccaatccagagaagagatgg gtgcgggagattatcaacgctttggagatgagctag

DBGET integrated database retrieval system