Myotis davidii (David's myotis): 102766876 Help Entry 102766876         CDS       T02992                                  Name (RefSeq) claudin-34-like   KO K06087   claudin Organism myd  Myotis davidii (David's myotis) Pathway myd03272   Virion - Hepatitis viruses myd04382   Cornified envelope formation myd04514   Cell adhesion molecules myd04530   Tight junction myd04670   Leukocyte transendothelial migration myd05160   Hepatitis C Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102766876  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102766876  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102766876  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102766876   09158 Development and regeneration    04382 Cornified envelope formation     102766876  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102766876  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myd03037]     102766876    04147 Exosome [BR:myd04147]     102766876    04515 Cell adhesion molecules [BR:myd04515]     102766876 Cilium and associated proteins [BR:myd03037]  Other cilia and associated proteins   Stereociliary proteins    102766876 Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102766876   Exosomal proteins of colorectal cancer cells    102766876 Cell adhesion molecules [BR:myd04515]  Immunoglobulin superfamily   L1 family    102766876 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM_230_134 DUF3522 DUF308 DUF2583 Motif Other DBs NCBI-GeneID:  102766876 NCBI-ProteinID:  XP_006775287 LinkDB All DBs Position Un AA seq 172 aa AA seqDB search MALFVHRNCQVVSFALNTLGWMFSMISMGLARWRLWYISAPSQGLACIGMWKVCTYQSAN LHSRKIECHRYTYSDTYLPLDIRIAQNLLLAASLLGLLGKVLMVPGLRRVYAGQLQKDTT CNLFFTSGVLSIIAGAFILTAVTWNYHSVFNEEGVRFPSSFHIPFRPDRQET NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggcccttttcgtccaccgcaattgccaggtagtgagtttcgccctcaacacccttgga tggatgttctccatgatttccatgggcctggccaggtggcgattgtggtacatctctgcc ccctcccaggggctggcatgcatagggatgtggaaggtctgcacttaccagtccgccaac ctccacagcagaaaaatagagtgtcaccgctacacctacagtgacacctacctaccgctt gatatccgcatcgctcagaacctgctgctggctgccagcctcctcgggctcctggggaaa gtgctcatggtcccgggtctgcggagagtgtacgcgggacagcttcagaaggacaccacc tgcaatctgttcttcacttccggagtcctgagcatcatagcgggtgcatttatcctcact gctgtgacctggaactaccactccgtgttcaatgaagagggcgtacgctttccgtcatcc ttccacatccccttcaggccggacaggcaggagacc

DBGET integrated database retrieval system