Myotis davidii (David's myotis): 102768202 Help Entry 102768202         CDS       T02992                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism myd  Myotis davidii (David's myotis) Pathway myd04081   Hormone signaling myd04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     102768202 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102768202 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myd04052]     102768202 (GAST) Cytokines and neuropeptides [BR:myd04052]  Neuropeptides   GPCR binding    102768202 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102768202 NCBI-ProteinID:  XP_006774447 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search MQRLCVQALILALALAAFSEASWKPRSQLQDAPSGPGAKRTLEARWLDQLGPVAHHQRQL RFPDPPHPVADLTKKQGPWLEEEEEAYGWMDFGRRSAEEGDQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcggctctgtgtgcaagcgctgatcctggctctggctctggccgccttctcggaa gcctcctggaagccccgctcgcagctgcaggatgcaccctcgggcccaggggccaagagg accctggaggcacgttggctggaccagctgggcccagttgctcaccaccaaaggcagctg aggttcccggatcccccacacccagtggcagacctgaccaagaagcaggggccgtggctg gaggaagaggaagaagcgtatggatggatggacttcggccgccgcagtgctgaggaaggg gaccagcagccctag

DBGET integrated database retrieval system