Myotis davidii (David's myotis): 102768801 Help Entry 102768801         CDS       T02992                                  Symbol SEC61B Name (RefSeq) Sec61 translocon beta subunit   KO K09481   protein transport protein SEC61 subunit beta Organism myd  Myotis davidii (David's myotis) Pathway myd03060   Protein export myd04141   Protein processing in endoplasmic reticulum myd04145   Phagosome Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     102768801 (SEC61B)    04141 Protein processing in endoplasmic reticulum     102768801 (SEC61B)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102768801 (SEC61B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myd04131]     102768801 (SEC61B)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:myd02044]     102768801 (SEC61B) Membrane trafficking [BR:myd04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     102768801 (SEC61B) Secretion system [BR:myd02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    102768801 (SEC61B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  102768801 NCBI-ProteinID:  XP_006758498 LinkDB All DBs Position Un AA seq 96 aa AA seqDB search MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT EDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcctggcccgacccccagtggcaccaacgtgggctcctcaggacgctccccgagtaaa gcggtggccgcccgggcggcgggtagcacggtccggcagaggaaaaatgccagctgcgga acaaggagcgcgggccgcacgacctcagcaggcactggggggatgtggcggttctacacg gaagactcccctggcctcaaagttggccctgttccagtattggttatgagtcttctgttc atcgcttctgtatttatgttgcacatttggggcaagtacactcgttcgtag

DBGET integrated database retrieval system