Myotis davidii (David's myotis): 102771437 Help Entry 102771437         CDS       T02992                                  Symbol CSTB, Cystatin-B Name (RefSeq) cystatin B   KO K13907   cystatin-A/B Organism myd  Myotis davidii (David's myotis) Brite KEGG Orthology (KO) [BR:myd00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:myd01002]     102771437 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:myd04147]     102771437 (CSTB) Peptidases and inhibitors [BR:myd01002]  Peptidase inhibitors   Family I25: cystatin family    102771437 (CSTB) Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102771437 (CSTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin DUF4616 Dynein_light Phage_Adaptor_PhiTE Motif Other DBs NCBI-GeneID:  102771437 NCBI-ProteinID:  XP_006764660 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MSATRRLIGGPSETRPATAEIQAIADKVKSQLEEKENKKYPTFEATEYKSQVVAGINYFI KVQVEDDDFVHIRVFESLPHENKALALHNYQTNKTKQDELAYF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgagcgctacccggaggctgattggcgggccctccgaaacccggcccgccacggctgag atccaggccattgccgacaaggtgaagtcccagctggaggagaaggaaaacaagaagtac cccactttcgaggccacggagtacaagagccaggtggtcgcggggattaactacttcatc aaggttcaagttgaagatgatgacttcgtgcacattcgagtgtttgaaagtctccctcat gaaaacaaggccttggccttgcacaattatcagaccaacaaaaccaagcaggacgagctg gcctatttctag

DBGET integrated database retrieval system