Myotis davidii (David's myotis): 102772200 Help Entry 102772200         CDS       T02992                                  Symbol CLDN11, Claudin-11 Name (RefSeq) claudin 11   KO K06087   claudin Organism myd  Myotis davidii (David's myotis) Pathway myd03272   Virion - Hepatitis viruses myd04382   Cornified envelope formation myd04514   Cell adhesion molecule (CAM) interaction myd04530   Tight junction myd04670   Leukocyte transendothelial migration myd05160   Hepatitis C Brite KEGG Orthology (KO) [BR:myd00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102772200 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102772200 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102772200 (CLDN11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102772200 (CLDN11)   09158 Development and regeneration    04382 Cornified envelope formation     102772200 (CLDN11)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102772200 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:myd03037]     102772200 (CLDN11)    04147 Exosome [BR:myd04147]     102772200 (CLDN11) Cilium and associated proteins [BR:myd03037]  Other cilia and associated proteins   Stereociliary proteins    102772200 (CLDN11) Exosome [BR:myd04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102772200 (CLDN11)   Exosomal proteins of colorectal cancer cells    102772200 (CLDN11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  102772200 NCBI-ProteinID:  XP_006764163 UniProt:  L5LU12 LinkDB All DBs Position Un AA seq 207 aa AA seqDB search MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAILCLVGGSVILCCSG DAQAFGENRFYYSSGSSSPTHAKSAHV NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggtggccacgtgcctgcaggttgtgggattcgtcacgagcttcgtgggttggatcggg atcatcgtcaccacgtccaccaatgactgggtggtgacttgcggctacaccatcccgacg tgccgcaagctggacgagctgggctccaaggggctgtgggcggactgcgtcatggccacg gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggttacgtgcaggcc tgccgagccctgatgattgcagcctcagtcctgggcctgccggccattctcctgctgctg accgttctcccctgcatccgcatgggccacgagcctggcgtggccaagtacaggcgggct cagctggctggggttctgctcattctgctagctctctgcgccattgttgccaccatctgg ttccctgtgtgcgcccaccgcgagaccaccatcgtgagctttggctactccctgtacgcc ggctggattggtgccattctctgccttgtgggtggctctgtcatcctctgctgctctgga gatgcgcaggcctttggtgaaaaccgtttctactactcttcgggctccagctcccccact cacgccaagagtgcccacgtataa

DBGET integrated database retrieval system