Myotis davidii (David's myotis): 107184444 Help Entry 107184444         CDS       T02992                                  Name (RefSeq) uncharacterized LOC107184444   KO K10784   T cell receptor alpha chain V region Organism myd  Myotis davidii (David's myotis) Pathway myd04014   Ras signaling pathway myd04015   Rap1 signaling pathway myd04020   Calcium signaling pathway myd04064   NF-kappa B signaling pathway myd04514   Cell adhesion molecules myd04612   Antigen processing and presentation myd04658   Th1 and Th2 cell differentiation myd04659   Th17 cell differentiation myd04660   T cell receptor signaling pathway myd04672   Intestinal immune network for IgA production myd04940   Type I diabetes mellitus myd05135   Yersinia infection myd05142   Chagas disease myd05144   Malaria myd05150   Staphylococcus aureus infection myd05162   Measles myd05166   Human T-cell leukemia virus 1 infection myd05169   Epstein-Barr virus infection myd05170   Human immunodeficiency virus 1 infection myd05202   Transcriptional misregulation in cancer myd05235   PD-L1 expression and PD-1 checkpoint pathway in cancer myd05310   Asthma myd05320   Autoimmune thyroid disease myd05321   Inflammatory bowel disease myd05322   Systemic lupus erythematosus myd05323   Rheumatoid arthritis myd05330   Allograft rejection myd05332   Graft-versus-host disease myd05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:myd00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     107184444    04015 Rap1 signaling pathway     107184444    04064 NF-kappa B signaling pathway     107184444    04020 Calcium signaling pathway     107184444   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     107184444  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     107184444    04660 T cell receptor signaling pathway     107184444    04658 Th1 and Th2 cell differentiation     107184444    04659 Th17 cell differentiation     107184444    04672 Intestinal immune network for IgA production     107184444  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     107184444    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     107184444   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107184444    05170 Human immunodeficiency virus 1 infection     107184444    05162 Measles     107184444    05169 Epstein-Barr virus infection     107184444   09171 Infectious disease: bacterial    05135 Yersinia infection     107184444    05150 Staphylococcus aureus infection     107184444   09174 Infectious disease: parasitic    05144 Malaria     107184444    05142 Chagas disease     107184444   09163 Immune disease    05310 Asthma     107184444    05322 Systemic lupus erythematosus     107184444    05323 Rheumatoid arthritis     107184444    05320 Autoimmune thyroid disease     107184444    05321 Inflammatory bowel disease     107184444    05330 Allograft rejection     107184444    05332 Graft-versus-host disease     107184444   09166 Cardiovascular disease    05416 Viral myocarditis     107184444   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     107184444 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  V-set Ig_3 Ig_2 ig I-set Motif Other DBs NCBI-GeneID:  107184444 NCBI-ProteinID:  XP_015425043 LinkDB All DBs Position Un AA seq 269 aa AA seqDB search MSVSGLLRVVITFMWLGSSIAQKVTQGQQAILVQEKEAVSLECTYDTSATSYSLFWYKQL TGGAMILLIRQDSYNQQNATGGRYSLNFQKAKSSANLIISASQLEDSAVYFCALSEPTVR GVLGGGVPKPQALLHASTWSSIAQKVTQGQQAILVQEKEAVSLECTYDTSVTSYSLFWYK QLSGGAMILLIRQDSYNQQNATGGRYSLNFQKAKSSANLIISASQLEDSAVYFCALSEPT VRGVLGGGVPKPQALLHASTCWRDQGGEL NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atgtcggtctccggtcttctgagggtggtcataactttcatgtggctagggtccagtatt gcccagaaggtaactcaaggccaacaagcaatactggtgcaggagaaggaggctgtgagc ctggagtgcacatatgacaccagtgctacaagttatagtctattctggtacaagcagctc accggtggggcgatgattctcctcattcgccaggactcttacaaccagcaaaatgccaca ggaggccgctactcactgaactttcagaaagcaaagagttctgccaacctcatcatctca gcttcccagctggaggactcagcagtgtatttctgtgccctgagtgagcccacagtgaga ggcgtgttaggaggaggtgtaccaaaaccccaggctctgcttcatgcatccacctggtcc agtattgcccagaaggtaactcaaggccaacaagcaatactggtgcaggagaaggaggct gtgagcctggagtgcacatatgacaccagtgttacaagttatagtctattctggtacaag cagctcagcggtggggcgatgattctcctcattcgccaggactcttacaaccagcaaaat gccacaggaggccgctactcactgaactttcagaaagcaaagagttctgccaacctcatc atctcagcttcccagctggaggactcagcagtgtatttctgtgccctgagtgagcccaca gtgagaggcgtgttaggaggaggtgtaccaaaaccccaggctctgcttcatgcatccacc tgctggagggaccaaggcggggaattgtaa

DBGET integrated database retrieval system