Mycobacterium sp. EPa45: AB431_03470 Help Entry AB431_03470       CDS       T03960                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mye  Mycobacterium sp. EPa45 Pathway mye00998   Biosynthesis of various antibiotics mye01100   Metabolic pathways mye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB431_03470    00074 Mycolic acid biosynthesis     AB431_03470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB431_03470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKK25917 LinkDB All DBs Position 761587..761832 Genome browser AA seq 81 aa AA seqDB search MTDIREEVLALVAAMAPDTAGEPELSSALVGDLGYTSLRLLELSIAVERAFELPQLDQEM LAGVATVGDLVNLVQAQKEPI NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccgacatccgcgaagaggtgctggccctggtcgccgcgatggctcccgacaccgcc ggcgagccggaactcagcagtgccctggtcggtgacctcggctacacgtcgctgcggttg ctcgaactgtcgatcgcggtcgagcgcgccttcgagctaccgcagctcgatcaggaaatg cttgccggcgtcgccacggtgggggacctggtgaatctcgttcaggctcagaaggagccg atatga

DBGET integrated database retrieval system