KEGG   Mycobacterium sp. EPa45: AB431_15630
Entry
AB431_15630       CDS       T03960                                 
Name
(GenBank) ribosomal subunit interface protein
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
mye  Mycobacterium sp. EPa45
Pathway
mye00624  Polycyclic aromatic hydrocarbon degradation
mye01100  Metabolic pathways
mye01120  Microbial metabolism in diverse environments
mye01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mye00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    AB431_15630
Enzymes [BR:mye01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     AB431_15630
SSDB
Motif
Pfam: Rieske Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: AKK27881
UniProt: A0A0G3IRF4
LinkDB
Position
complement(3273077..3274444)
AA seq 455 aa
MSAETIETTDTTDPYLQGALRDVAEALAVGRLPARVISDPALHPVEMQRIFARAWVFLGH
ESELPNSGDFVVRYIGADSVILCRDESGRIQALSNSCRHRGTLVCRAETGNSAHFTCPYH
GWVYSNTGDLVGVPAMKEAYPGGFDKAKWGLRHIPHLDSYAGFIFGSVDPAAPSLGDYLG
DMTFYLDLIAKKTAGGMEVIGAPHRWVMGANWKTGADNFVGDSYHTLFAHRSMIELGMAP
GDPNFASAPAEIGLQNGHGVGVLGFPPTLAEFPEYEGYPDEVVDQMADSYPTTAHKELFR
RSAFIHGTVFPNLSFINVTIAADHMSPPTPFVSFRLWRPLSHDRMEVLSWFLVERDAPEW
LREASQASYVRNFGPAGVFEQDDAEAWKAITEAVQGPFAGDGLLNYEMGMDLTPITDWPG
PGQAVPSGYAEQNQRRFWARWLDYMSQPPAPRGRA
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgagcgccgagacaatcgagacgaccgacacgaccgatccctaccttcagggtgcactg
cgcgacgtagcggaggcgctcgcagttgggcggttgcccgcccgggtcatcagcgatccg
gcgctacatccggtcgagatgcagcggatctttgcccgcgcatgggttttcctcggacac
gagtctgagttgcccaattccggggactttgtcgtgcgctacatcggggccgactcggtg
attctctgtcgggacgagtcgggccgcatccaggcgctgtcgaactcttgccgacaccgc
ggcaccctcgtatgccgagcggagacgggcaacagcgcgcacttcacgtgcccctaccac
ggctgggtatacagcaataccggtgacctcgtcggcgtgccggctatgaaggaggcgtat
cccggcggctttgacaaggccaagtgggggctacgccacatcccccatctcgattcctat
gcggggttcatcttcgggagcgtcgatccggcggcgccgagcctgggcgactacctcggc
gacatgacgttctacctcgacctcatcgcaaagaagaccgcgggcggtatggaggtaatt
ggcgcgccgcaccggtgggtgatgggggccaactggaagacaggcgccgacaattttgtc
ggcgactcctaccacaccctctttgctcaccgctccatgatcgagctgggcatggcgccc
ggtgatccgaacttcgcgagcgcaccggccgagatcgggctccagaacggccacggcgtc
ggtgtgctcggcttcccccctacgctcgcggagttccccgagtacgagggataccccgac
gaggttgtggaccagatggccgactcgtatcccaccacagcgcataaggaactcttccgc
cggtcggccttcatccacgggacggtcttcccgaacctgtcgttcatcaacgtgaccatt
gcggctgaccacatgtcgccgccgaccccgttcgtcagtttccggctgtggcggccgctc
tctcatgaccggatggaggtcctttcctggttcctggtcgagcgggatgcacccgagtgg
ctccgagaggcgtcccaggcgtcctacgtgcgcaacttcgggcccgccggcgtgttcgag
caagacgacgctgaggcctggaaggccatcacggaggccgtgcagggtcccttcgccggt
gacgggttgctgaactacgagatgggcatggacctgacaccgattaccgactggccgggg
ccgggtcaggccgtccctagcggctacgccgagcagaaccagcggcggttctgggcgaga
tggctggactacatgagccagcccccggcgccccgcgggcgcgcctga

DBGET integrated database retrieval system