Mycolicibacterium sp. HK-90: QU592_09975 Help Entry QU592_09975       CDS       T11081                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism myh  Mycolicibacterium sp. HK-90 Pathway myh01100   Metabolic pathways myh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:myh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QU592_09975    00074 Mycolic acid biosynthesis     QU592_09975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QU592_09975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WKG05374 LinkDB All DBs Position complement(2060763..2061032) Genome browser AA seq 89 aa AA seqDB search MQSTTPEAVSAALTEILRDDMNVDVRRVTRDSRLIDDVGLDSVAFAVGMVAIEDKLGVAL SEEDLLSCDTVGDLEAAILAKVPAAQSTQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcagtcgactacgcccgaagcggtcagcgccgctctcaccgagatccttcgtgacgac atgaacgtcgacgtccgccgggtgaccagggactcccgactgatcgacgacgtcggcctg gattcggtggcctttgccgtcggcatggtggcgatcgaggacaagctcggggtggccctc tccgaggaagacctgctcagctgcgacaccgtcggcgacctcgaggcggcaatcctggcg aaagtgcctgccgcgcagagcacccagtga

DBGET integrated database retrieval system