Mizuhopecten yessoensis (Yesso scallop): 110444553 Help Entry 110444553         CDS       T05079                                  Name (RefSeq) GTP-binding protein SAR1-like   KO K07953   GTP-binding protein SAR1 [EC:3.6.5.-] Organism myi  Mizuhopecten yessoensis (Yesso scallop) Pathway myi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:myi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110444553  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:myi04131]     110444553   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:myi04031]     110444553 Membrane trafficking [BR:myi04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Coat protein complex II (COP-II)     110444553 GTP-binding proteins [BR:myi04031]  Small (monomeric) G-proteins   Arf/Sar Family    Sar     110444553 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf SRPRB G-alpha MMR_HSR1 Roc AAA_29 Gtr1_RagA ABC_tran FeoB_N Motif Other DBs NCBI-GeneID:  110444553 NCBI-ProteinID:  XP_021344599 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MFLWDWMQSVLQFFGFNRTAKIMIVGLDNAGKSTLLTMLKTGRAVQFPPTGQARCEEMTI GGLTIQAYDLGGHMTMRRVWLDYFPAVDGIVYIIDSADRERLQESKNELS NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtttctctgggattggatgcagtcagttctgcaatttttcggcttcaatagaaccgct aagatcatgattgttggactggacaacgcgggcaagtccaccctactgaccatgctgaag acaggacgtgctgtgcagttcccgccgacaggccaggcacgatgtgaagagatgactatt ggtggacttaccatacaggcatacgatctcggcggacatatgacaatgcggagagtttgg ctggattacttccccgctgtagatgggattgtttacatcatcgactcggcagacagagag agactccaggagagcaaaaacgaactttcg

DBGET integrated database retrieval system