Mizuhopecten yessoensis (Yesso scallop): 110446750 Help Entry 110446750         CDS       T05079                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism myi  Mizuhopecten yessoensis (Yesso scallop) Pathway myi03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:myi00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     110446750  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:myi03036]     110446750    03400 DNA repair and recombination proteins [BR:myi03400]     110446750 Chromosome and associated proteins [BR:myi03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      110446750 DNA repair and recombination proteins [BR:myi03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      110446750 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Histone DegS Bromo_TP CBFD_NFYB_HMF TAF TFIID_20kDa TFIID-18kDa Motif Other DBs NCBI-GeneID:  110446750 NCBI-ProteinID:  XP_021347725 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search MATEDDDMDNLQHRQRLKASVHHTVVRICSELQDDDSKVPINNSVMAAIAETTWRYVQDV TQDLEMFAKHAKRTTVNADDVKLLLRKCPKLLEHISGIHQTHTESKVKQKKKTATKKKSS AAAVADSDEEH NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcgactgaagatgatgacatggataatctacaacacagacagagactgaaggcatcg gtccatcatactgtggtgagaatctgttcagaactacaagacgacgactccaaggtccct ataaacaactccgttatggcagccatcgctgaaacaacatggcgatacgtccaagatgtt acacaagatttagaaatgtttgctaagcatgccaaaagaaccactgttaatgcagatgat gtcaagcttcttctgaggaaatgtccaaaactcttggagcatatctcgggcatccaccag acacatactgaaagcaaggtcaaacagaagaaaaagactgcaaccaagaagaaaagtagt gcagctgccgtagccgactcagatgaggagcactga

DBGET integrated database retrieval system