Mycobacterium sp. djl-10: BCA37_11015 Help Entry BCA37_11015       CDS       T10620                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism myj  Mycobacterium sp. djl-10 Pathway myj01100   Metabolic pathways myj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:myj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BCA37_11015    00074 Mycolic acid biosynthesis     BCA37_11015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BCA37_11015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ANW64056 LinkDB All DBs Position complement(2209833..2210093) Genome browser AA seq 86 aa AA seqDB search METPTPEAVSAALSEILRDDLTIDISRVTRDSRLIDDVGLDSVAFAVGMVAIQDRIGVTL SEEDLLTCNTVGDLEDAIMAKVPAAR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggagacgccaacccccgaggctgtcagcgcggccctctcggagatcctgcgcgacgac ctcaccatcgacatcagccgtgtgacgcgtgactcccggctgatcgacgacgtgggcctg gattccgtcgcttttgccgtcggcatggttgcaatacaggaccggatcggggtgacgctc tccgaggaggacctgctcacctgcaacacggtgggcgacctggaagacgcgatcatggcg aaggttccggccgcccggtga

DBGET integrated database retrieval system