KEGG   Mycobacterium sp. djl-10: BCA37_11160
Entry
BCA37_11160       CDS       T10620                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
myj  Mycobacterium sp. djl-10
Pathway
myj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:myj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BCA37_11160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:myj02000]
    BCA37_11160
Enzymes [BR:myj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     BCA37_11160
Transporters [BR:myj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    BCA37_11160
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 nSTAND1 RsgA_GTPase AAA_22 AAA_16 SbcC_Walker_B ORC-CDC6-like AAA_33 GAF_NLP Arf AAA_23
Other DBs
NCBI-ProteinID: ANW64079
LinkDB
Position
2235389..2236189
AA seq 266 aa
MTGPAATHSVAGDDIVVSAQAVTKRFGDTLALDEVSLEVRRSEMMVLLGLSGSGKSTLLR
CLNGLQPVTSGTVEVGGTRVDRAGGRELRALRRNVGFVFQHFNLVGRLSCLENVLIGGLG
RLSMPRYGALTYPKRMRVEALDYLDRVGLADYADRRADTLSGGQQQRAAIARTLMQQPGL
VLADEPVASLDPENAGVVMDLLFRVCIEEKLTVVCTLHQVDLALGWAHRLVGLRSGRKVL
DRPAVGMTREEVMAIYQRVDPTQVRT
NT seq 801 nt   +upstreamnt  +downstreamnt
gtgaccggccctgcggcaacacattcggtggccggcgacgatatcgtcgtctccgcccag
gctgtcaccaaacggttcggtgacaccctcgctctcgatgaggtgtccctcgaggtgcgc
cgcagcgagatgatggtgctgctcggcctctccgggtctggaaagtccacgctgctgcgc
tgcctcaacggcctgcaaccggtgacgtcggggaccgtcgaggtggggggcacccgggtg
gaccgggccggcgggcgcgaactgcgcgccctgcgccgcaatgtcggattcgtcttccag
cacttcaacctcgtgggccggctcagctgcctggagaacgtcctcatcggtggtctgggc
cggttgtcgatgccccgctacggcgccctgacctacccgaagcggatgcgggtggaggcc
ctcgactacctggaccgggtgggtctggccgactacgccgatcgccgggcggacacgctg
tcggggggacagcagcagcgggctgcgatcgcccggaccctgatgcagcagccgggtctg
gtgctggccgacgaaccggtggcctcgctggacccggagaacgccggtgtggtgatggac
ctgttgttccgcgtctgcatcgaggagaagctcaccgtggtgtgcacgctgcaccaggtg
gacctggcgctgggctgggcccaccgcctggtcggattgcgttccggacgtaaggttctc
gaccggccggcggtgggtatgacccgcgaggaagtgatggcgatctaccagcgggtcgat
cccacccaggtgcgcacgtga

DBGET integrated database retrieval system