Mycobacterium sp. djl-10: BCA37_29725
Help
Entry
BCA37_29725 CDS
T10620
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
myj Mycobacterium sp. djl-10
Pathway
myj02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
myj00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
BCA37_29725
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
myj02000
]
BCA37_29725
Enzymes [BR:
myj01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
BCA37_29725
Transporters [BR:
myj02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
BCA37_29725
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
SMC_N
AAA_16
AAA_29
AAA_22
RsgA_GTPase
AAA_15
AAA_30
NACHT
AAA_23
SbcC_Walker_B
MMR_HSR1
DUF2813
AAA_19
AAA_28
TsaE
SRP54
AAA_18
DUF3584
Motif
Other DBs
NCBI-ProteinID:
ANW68187
LinkDB
All DBs
Position
6206311..6207060
Genome browser
AA seq
249 aa
AA seq
DB search
MAIEVRDLRMRFRRGNADVLAGVDLRIGHGETVALIGTNGAGKSTLLRCLVRLIEPTSGT
VTLAGTDVTAAPKRALRGIRRDVGFVFQRFHLIPRLTVFHNVVHGAMGRHGTRCAWPLTS
PTDVRREAMESLERVGLAGMAGQRVDTLSGGQQQRVAIARMLMQRPTLILADEPVASLDP
ASATTVMELLSSIAAERNVTVVMALHQMDLALRYASRVVGLRGGTVDFDQLSADCDAARL
APVFAGGIS
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atggcaatcgaggtccgggatctccggatgcgcttccgacgaggcaacgcagacgtcctc
gcgggggtcgatctccggatcgggcacggtgagacggtggctctgatcggaaccaacggt
gcgggcaagtccactctgctgcgatgcctggttcggttgatcgaacccaccagcggcaca
gtgactctggccgggacggacgtgaccgccgcaccgaagcgggcgttgcggggcatccgg
cgcgacgtcggcttcgtcttccagcgcttccacctgattccccgtctcaccgtgttccac
aacgtcgtccacggtgcgatggggcggcacggcacccgctgcgcctggccgctgaccagt
ccgaccgacgtgcgtcgggaggccatggaaagcctggagcgagtgggactggccgggatg
gccggccagcgggtcgacaccttgtcggggggccaacagcagcgcgtggcgatcgctcgg
atgctgatgcagcgaccgacgctgatcctggctgatgaaccggtggccagcctggacccg
gcctcggcgaccacggtcatggagctgctgtcctcgatcgccgccgaacgcaacgtcact
gtggtgatggccctgcaccagatggatctggcgctgcgctacgccagccgagtggtcggg
ttacgcggcggcacagtcgacttcgaccagttgtccgctgactgcgatgcagcgcggctg
gctccggtatttgccggcggtatctcgtga
DBGET
integrated database retrieval system