Mycetocola zhujimingii: C3E77_13480 Help Entry C3E77_13480       CDS       T05409                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism myl  Mycetocola zhujimingii Brite KEGG Orthology (KO) [BR:myl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:myl03032]     C3E77_13480    03036 Chromosome and associated proteins [BR:myl03036]     C3E77_13480    03400 DNA repair and recombination proteins [BR:myl03400]     C3E77_13480 DNA replication proteins [BR:myl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C3E77_13480 Chromosome and associated proteins [BR:myl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C3E77_13480 DNA repair and recombination proteins [BR:myl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C3E77_13480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Pyruv_OxRed_insertion Motif Other DBs NCBI-ProteinID:  AWB87513 UniProt:  A0A2U1TBP4 LinkDB All DBs Position complement(2824038..2824325) Genome browser AA seq 95 aa AA seqDB search MADKSLNKTELVAKIAAETNQSQATVGGVLDSLFGVLADSVSNDVKVTIPGWLAVERTAR AARTGRNPQTGAEIQIPAGHSVKVSAGSKLKAAAK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgataagtcgcttaacaagaccgagctcgttgcaaagatcgcagctgagaccaac cagagccaggctaccgtcggtggcgtcctcgactcgctgttcggcgtgctcgctgactcg gtcagcaacgacgtcaaggtcaccatcccgggttggctcgccgtcgagcgcaccgctcgt gcagctcgcacgggtcgcaacccgcagaccggcgccgagatccagatcccggccggccac tccgtcaaggtttccgctggttccaagctgaaggctgctgcgaagtag

DBGET integrated database retrieval system