Myxococcus hansupus: A176_000252 Help Entry A176_000252       CDS       T04077                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mym  Myxococcus hansupus Pathway mym01100   Metabolic pathways mym01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mym00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A176_000252    00074 Mycolic acid biosynthesis     A176_000252   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A176_000252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKQ63340 UniProt:  A0A0H4WPT5 LinkDB All DBs Position 294846..295124 Genome browser AA seq 92 aa AA seqDB search MVERELEVITEIHRIVADELEWKGTVEPAQDLVRDLQLDSLGLTVLAVGLENRFRIRLSE EDAQGVRTVGDLAKLVARRVAAPPDAVTEVGT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggttgagcgcgaattggaggtcattaccgagattcaccgcatcgtcgccgatgagctg gagtggaagggcaccgtggagcccgcgcaggatttggtgcgcgacctccagttggacagc ctggggctcacggtgctcgcggtggggctggagaaccgcttccgcatccgcctgtccgaa gaggacgcgcaaggcgtgcgcacggtgggagacctggcgaagctggtggcccggcgagtc gcggcgcccccggacgcggtgaccgaggtcggcacgtga

DBGET integrated database retrieval system