KEGG   Pseudomyxococcus hansupus: A176_003294
Entry
A176_003294       CDS       T04077                                 
Name
(GenBank) hypothetical protein
  KO
K03395  aminoglycoside 3-N-acetyltransferase I [EC:2.3.1.60]
Organism
mym  Pseudomyxococcus hansupus
Brite
KEGG Orthology (KO) [BR:mym00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:mym01504]
    A176_003294
Enzymes [BR:mym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.60  gentamicin 3-N-acetyltransferase
     A176_003294
Antimicrobial resistance genes [BR:mym01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    A176_003294
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_6 FR47 Acetyltransf_3
Other DBs
NCBI-ProteinID: AKQ66382
UniProt: A0A0H4XE74
LinkDB
Position
4143360..4143824
AA seq 154 aa
MQETTYQRLRAADADLALMRDLNAVFAEAFEDPEAYAQPPEDDYLRAILGREETVVLVAR
VDSQVVGGLVAYELPKLERRCSELYVYDLAIATPFRRRGIASELFVRLRKIAADRGIPVI
FVQADAGDAPAVGLYAGMGTREDVAHFDITTTKA
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcaagaaaccacctaccagcggctccgcgccgcggacgccgacctggcgctgatgcga
gatctgaacgccgtcttcgcggaggcgttcgaggaccccgaagcgtatgcccagcccccc
gaggacgactacctgcgcgccatcctcggccgagaggagacggtcgtcctggtggcccgg
gtcgacagccaggtcgtgggcggactcgtggcctatgagctccccaagctggagcggcga
tgcagcgagctctacgtgtatgacctcgccatcgcgacgccgttccggcgccggggcatc
gcgagcgagctgttcgtgcgcctgaggaagattgccgcggaccgcggcatccccgtcatc
ttcgtccaggcggacgcgggagatgcgccggccgtcggactctacgcgggcatgggcacg
cgcgaggacgtggcgcacttcgacatcacgaccacgaaggcctga

DBGET integrated database retrieval system