Myotis yumanensis (Yuma myotis): 138994026 Help Entry 138994026         CDS       T10762                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism myum  Myotis yumanensis (Yuma myotis) Pathway myum04060   Cytokine-cytokine receptor interaction myum04061   Viral protein interaction with cytokine and cytokine receptor myum04062   Chemokine signaling pathway myum04620   Toll-like receptor signaling pathway myum04621   NOD-like receptor signaling pathway myum04623   Cytosolic DNA-sensing pathway myum04668   TNF signaling pathway myum05020   Prion disease myum05142   Chagas disease myum05163   Human cytomegalovirus infection myum05164   Influenza A myum05168   Herpes simplex virus 1 infection myum05323   Rheumatoid arthritis myum05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:myum00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     138994026 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     138994026 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     138994026 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     138994026 (CCL5)    04621 NOD-like receptor signaling pathway     138994026 (CCL5)    04623 Cytosolic DNA-sensing pathway     138994026 (CCL5)    04062 Chemokine signaling pathway     138994026 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     138994026 (CCL5)    05168 Herpes simplex virus 1 infection     138994026 (CCL5)    05163 Human cytomegalovirus infection     138994026 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     138994026 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     138994026 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     138994026 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     138994026 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:myum04052]     138994026 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:myum00536]     138994026 (CCL5) Cytokines and neuropeptides [BR:myum04052]  Cytokines   Chemokines    138994026 (CCL5) Glycosaminoglycan binding proteins [BR:myum00536]  Heparan sulfate / Heparin   Chemokines    138994026 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Hydrolase_4 Motif Other DBs NCBI-GeneID:  138994026 NCBI-ProteinID:  XP_070249718 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSAAAFAVLLAAAAFCAPASASPYASDTTPCCFAYISRPLPRAHLQEYFYTSSKCSMP AVVLITRKNRQVCANPEKRWVREIINALEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagctgccttcgccgtcctcctcgctgcagccgccttctgtgctcct gcatcggcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc ccactgccccgtgcccacctccaggagtatttctacaccagcagcaagtgctccatgcca gcagtcgtcttaatcacccgaaagaaccgtcaggtgtgtgccaatccagagaagagatgg gtgcgggagattatcaacgctttggagatgagctag

DBGET integrated database retrieval system